SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.03495 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.03495
Domain Number 1 Region: 116-273
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-27
Family MAM domain 0.006
Further Details:      
 
Domain Number 2 Region: 66-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 29-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.03495
Sequence length 294
Sequence
MDTEIHLPAVSKNISEIFISGQTCDVADVPNFICPSGKCLRTDLLCDSDKNCDDGTDEMR
CGLGMGCSKDEFSCADGGCVSWALTCNGEKDCEDGTDEPLFCKKRDSANCSLLNLVKCDF
EVGFCGLKHESKSLRWLIASGFTPEKSTFRPSFDHTTFSPTGRYMFIEPSTYYQTDLSAV
LASDVIDKGEIICIQFWYYMRGQDIDSLKINIRTDKSKRLIWQLTGEQGNKWAFAQVGHK
DDSASYQVLLEGAFNGSGINRVIAVDDLYFSSEKECLTLPTKGNGSCSVYLLCC
Download sequence
Identical sequences adi_v1.03495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]