SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.03548 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.03548
Domain Number 1 Region: 417-529
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-23
Family YWTD domain 0.0000742
Further Details:      
 
Domain Number 2 Region: 184-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000864
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 3 Region: 108-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 4 Region: 230-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 5 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 144-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 65-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 309-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000236
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 271-304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 536-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000861
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.03548
Sequence length 779
Sequence
MTLLAKAVVLCVVHSVVVATSSSNASASFHCGDGKFACGSQKCIPDRWRCDDYDDCGDQS
DEVGCPEKTCLDHRFNCTNGRCVWKSFVCDFDDDCGDGSDEVGCDRNHTCPDNKFKCKSG
KCIDILWKCDGENDCVDNSDETSCETATCPSNKFTCNNNNCVPRSHLCDGDDDCEDNSDE
TTDQCASLTCSSNQFTCPNHMCIPSRWRCDGDADCSDGSDEKGCNTHITRSPQVCAEQMF
SCNDGNCIRNSWRCDGENDCQDGSDEERCSTCSSDKFKCGNASLCIPQSQRCNGKRDCPN
GEDEPLSCDIDECEVFGQCSQDCINMKGTFECSCKPGYHLDANKMLCRAAVFLCSGVVEN
LLLLEADLKAEELSSICEASFDALRGSFSVGDKSSIVCKEEVLDQPFLGLDVGLKALSPE
GIAVDWASKKIYWTDGGHNVIEVAEFDGSHRLTLFYNDIYDPRAIVVDPFHGYLFWTDWF
TNSPRIERSGMDGNPSTRTVVVSERLGWPNALAIDYTLQRIFWADANDFCFKFSVTNPCE
VNNGNCSHLCLLAVAPMGRSCRCPNGMQMQSGNGTCTGTPINKPVGPNISATTPSSQSTT
KASTAEPTTPTSKPLDSVTTSSPSKAPGSKTEQGKDESKTVSTASPTKPSTKPSRARSNE
SLRKTTSPTASGKTATKEDSNSTQKHEDPIIVSAKRKDNSKHRGLPSGAIIGIVVAIAFV
VVFVVGTIWFMLRRTKSYGGKTIVYHKDATTKPLAEDFDNDESFKAFDDKAYRERVEFA
Download sequence
Identical sequences adi_v1.03548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]