SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.03894 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.03894
Domain Number 1 Region: 460-564
Classification Level Classification E-value
Superfamily SRCR-like 1.18e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 157-317
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-34
Family MAM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1027-1108
Classification Level Classification E-value
Superfamily RING/U-box 7.24e-21
Family U-box 0.0042
Further Details:      
 
Domain Number 4 Region: 670-757
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-19
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 5 Region: 326-362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 117-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000668
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 7 Region: 405-454
Classification Level Classification E-value
Superfamily SRCR-like 0.00000902
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0027
Further Details:      
 
Domain Number 8 Region: 69-113
Classification Level Classification E-value
Superfamily SRCR-like 0.0000183
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 
Weak hits

Sequence:  adi_v1.03894
Domain Number - Region: 362-405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000157
Family MAM domain 0.024
Further Details:      
 
Domain Number - Region: 4-66
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0855
Family MAM domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.03894
Sequence length 1112
Sequence
MDIYVHMRGRHIGEFNIYQAPVIGFAVRKLSIAGELGTNWVKQEIQFDSKVEFQIIIEGV
LSPVYGPFTGAYNVRCQGNETSIKNCKIGAWSNSSTCTSNQSMVNCSGIRPVCPLKTHLN
CPADSSGNKTCITHGQLCDFTKDCWDGSDELDCDNYTRCDFNDTQICGWLQVSNDQMDWS
RNKGSTPSWYTGPSSDHNGNPSAYYLYMEVSGRQGGEKAAMLVTPRFNGDYNGRCKVRFY
YHMKGNGIGALRVIATDRYSRRTMWSKELHQGSPWMRAEVQLANLSSSFQVYFEGEHKGF
TAHGDIAIDDVSFTPECRPTPHENVSCTQDNFPCGSGDCVPLSSVCDFNNDCFDASDELN
CGNAMGTLRVLLRNSITREESSIWQRSGNQGNQWIRASVPLNTSWRVTQVPQGPSPMSLK
SVHCKGNEDTLGDCITDWKRANCDHNYAGVRCSAEGTAEGNIRLRGGSSRKEGRVEIFHQ
GEWGTVCDDYWKKENARVVCYELGFTAVLEYKRSFGPGSNRIWLDRVNCNGNETALVKCS
HRGWGITSCNHREDVGVICSDQALIGCYNNTNRQAMKLEFKAPTMTPVKCLRRCQSKGLK
YAALLWGEECYCGNSYDRSGKATTCNIPCRGDVTKICGGIWAFSVYNTDPAIIPTSIPRH
AAVTQSKCCCSDCVWVITLQSGKRVKVSFKFFITEHFYDYVEIRDGEKHYSVPYLSPIGG
FSGNSSYSVVASSNVIWIKFHSDPSVTAKGFNLTYEAIGVSTQVVSTTAIPPSKLPNIQR
IEGVSPSTTSTPGIGEDEARKGMSAGAVTATVLSVVFAVIVSVVLVTFCFLKKKKRDHRG
VRHQFVNEAYDNVQGMGMTQNGANPNYAQPVITNEARLPGQDNGAFFPAAPPPYSQTAGG
NSYQTPLELEDRGYALLYSTPPAYEATAWTQGNKTTSTGIGSVTSLREAARDDGLAANGA
VSAAPLSRAVLPPIRGTHGSAQSEKNGLPLEDEAGPLPDKPPLMVNVMPEPTAPPPVNIL
LRPIAADANPEQEFDGDVPFEFLCPITNKIMKDPVTASDGYDYERQAIRRWFRRKRTSPV
SNEELTDLTFRANDELRNRISVFMGEHSSVSQ
Download sequence
Identical sequences adi_v1.03894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]