SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.04391 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.04391
Domain Number 1 Region: 139-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-29
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 2 Region: 20-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-28
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 3 Region: 254-376
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-25
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 4 Region: 394-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.04391
Sequence length 623
Sequence
MVHVSSKPSYNSHSEDLSRCDLTLTNSNGKIQSPNYPNTYPANKECSWTIILPEFQRIVL
VFETFNLQPASSSEIYSIGCERDHIAVYDGANFVGKYCAGNIPPRQITTKGRTLRVVFKS
GNRTTQRFLSNFSALYAACGGYFTGAEGSISSPGHPYGFAANIQCQWKVRVPTDYVIQLI
FNDFNMDRKYPCNIDYVRVLDGLNSSDTVIRQFCSTRLPQKSILWSTGNTLSLEFKSHRE
SNSKGFQVHYSRMPHCNGLMKSDYGRFKSPGYPVSRKMDNQCKWLLSVSEGKIVSLMFDS
FDVDSESSTFSTPGDCKDDYVEVFDGREDKDNLLGRFCTINNKPISMVRSTGRSMLVRLK
TSPWNKGKGFVASYYGLSPDNYFGNCNVFDNKLLFTCNSGRRIPCQLQCDGTYDCPDASD
ERQCNHITTASSQKTTGIQNYVIVILSATGSILSIICIFFIVDKVKSKRTTSTRRRRRIS
RPGRSHLRMHAAINNALTEEPSSPPPPYDVSGSSNPGDIFEVAFSHSNLRGICPSVSSTW
SSGLQTHETQVARNNQTQNQTLVPMNQEDTSNITIQEVTAQNILQGTQTSNTEEETGTIS
PSESTNCVNDTTQLIRSDSVIAL
Download sequence
Identical sequences adi_v1.04391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]