SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.05533 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.05533
Domain Number 1 Region: 133-171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000301
Family LDL receptor-like module 0.0044
Further Details:      
 
Weak hits

Sequence:  adi_v1.05533
Domain Number - Region: 99-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00301
Family LDL receptor-like module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.05533
Sequence length 193
Sequence
MKFYRSRKSYILCSLCIVIIFVFFSHWKTVSILDHRNSISVLHDKQNKRNVKTDRNAERN
EKCKLGKGQKIADNCANILKDVVGVAPSDMRNYQPNEDGFFTCLDGKWNITWNSVNDDYC
DCNDGTDEPGTDACPNTKFYCAGRAFYLPSSRINDGICDCCDGSDEWKEMTVRGDVLQEH
DFNVKYAPCINTC
Download sequence
Identical sequences XP_015757350.1.88439 adi_v1.05533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]