SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.06110 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.06110
Domain Number 1 Region: 345-477
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-26
Family MAM domain 0.0038
Further Details:      
 
Domain Number 2 Region: 137-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-17
Family MAM domain 0.0072
Further Details:      
 
Domain Number 3 Region: 305-342
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 257-301
Classification Level Classification E-value
Superfamily SRCR-like 0.0000222
Family Scavenger receptor cysteine-rich (SRCR) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.06110
Sequence length 478
Sequence
MWTIFVALTFHFGNLARTWGNINFATPVKCQYHHDETELVCDNIFNPFLVPEISEATKRI
VFTSDTLVCDCSLKNLLEWKKTVQQSRDLILQGLCSSPENLHGRSIDGLSPEETHCISEL
QDQPVLVRRRRASGPVLPCDFEQGFCQWFHSVDDEFDWTRNNGSTPSFWTGPTADHTKGT
KYGYYVYIETSLPRARHQKARLVSPTLAPVQPNTTCKNWQARSATSQLKRVSSAELRAFS
GQTDPALEVSPVYGPFTGAYNVSCQGNETSIKNCKIGAWSNSRTCASNQSMVNCSGIRPV
CPLKTHLNCPADSSGNKTCITHGQLCDFTKDCWDGSDELDCDNYTRCDFNDTQLCGWLQV
SNDQMDWSRNKGSTPSGYTGPSSDHNGNPSAHYLYMEVSGRQGGEKAAMLVTPRFNGDYN
GRCKVRFYYHMRGIGIGALRVIATDRYSRRTMWSKEFHQGSPWMRAEVQLANLSSSFQ
Download sequence
Identical sequences adi_v1.06110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]