SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.08089 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.08089
Domain Number 1 Region: 81-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000591
Family Canonical RBD 0.008
Further Details:      
 
Domain Number 2 Region: 160-201
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000389
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.08089
Sequence length 287
Sequence
MKELPTQDEYPKSVVLHFPPSVYQKIGAAEMIPKLLEIFNVEDLRCLQFLRNGKVRVSFR
EKEVSDHYLVEGMRFGDHDIPVIKDGQKVSVLYIRDLPYEVSSDELVDFFSNYGEVLTGE
RFVAENFPNLCNGNRVLKMILNEELPYFLSVCGCQCRVWYRGQPIQCFVCRELGHRAQAC
RLSGRWRHCHQVGHMARECARAWDPHPSVSAVPADVDPPVKPVADSVDNSSDAVMTSEDV
DKSVDEPPVDKLVDKLPVAPINDVDKPSAIPLCSTMXXXALGTMTSQ
Download sequence
Identical sequences adi_v1.08089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]