SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.09855 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.09855
Domain Number 1 Region: 787-841
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000119
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 476-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.027
Further Details:      
 
Domain Number 3 Region: 846-884
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000903
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.09855
Sequence length 1012
Sequence
MVKVASLAEILWISCLFSSISSELDPGEQAKVTTALDTAQFAMNAINEEYVAQAKAIEEA
LKVSTQAKSADLLKRQTELAKFGSKVGKALKAVQAASAIASFVFTFFMPSELDVITSLIN
ERFNEVNAKLDRIDEKLDEMEKSIKADTAFNVFLSAWIKWEYKARNGAKKLSDIRKAMGT
KTRRIDQVKLAEEYVKYYETNNLDGNVLNLYRMAALPEGGTQRNIFDRFIAQFGCDITKL
SELMILVKNIMISAGQQELTYYYFKGDQSRANSSFKDIQMYFFEIRRAFDDRVWHCRRDS
LDNAKRDANKILKNMKGSSRESIVRAIFNELKLKYPWYTWAVAAVKSDRPSIPDLELRGS
TYFRLEDRSDANKVKGYFVVYEDTRSSASCSDITQAKTLLVFKKCDGCNSDYVYAADNIL
TKKRCGESTLERVVNFRDQCHLCVYVSPYPTCYCADLVKEEVKTWAFIASAVNTIKDICT
SDKCSSHGQCRQIPFTTTHQCICNRGYEGESCERRLDFDDTIEKLIAELRKTFKVVNYVP
TTVDVFFSIRSLSKKLNVVLQKIKTSFAHTNNIIQHSQTIYNVEDIADLYAKLQKNEMTF
DQFGRRIENYLKTVSTFMLQNRFKKMILGQGTLDNPGNDIYNSYKREYLSHNGGGCSAKY
NEDVKGFRDSLAYLDQALGEALLLHQKWLLETRGTTKTLQTKYKKEAQYIQNIFKGRQLK
YNQYWKNYSCGSLSVDGAGVSCKDELSFEGMTVTLKCDKQRLATPRQVTCKKIGNVLKWD
SQPKCKFVWGNFGGWNRCSKTCGGGFKRRYRSCLGTTNIQHCKRDQGGLNYQTVSCETQD
CCSSQYGKFKCSNRKCISKSLICDGNNDCGNNDDESRYRCPNYIRSGDLIALKSNAKTNK
WLSCYCTVNCGVKRCKLRGCPGSQMTGSDWNSCSSEAFVLYLTGYGKGEPVRSGDRIALY
YGADHWLSCSGSGRVCPTRSCPGYGRRDCRPCRKSSLKNASITSERMIESKN
Download sequence
Identical sequences adi_v1.09855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]