SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.09856 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.09856
Domain Number 1 Region: 1859-1896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 2492-2617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000534
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 3 Region: 785-839
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000889
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 1817-1854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000544
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 5 Region: 845-883
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000108
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 474-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000111
Family EGF-type module 0.024
Further Details:      
 
Domain Number 7 Region: 1782-1827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000453
Family EGF-type module 0.026
Further Details:      
 
Domain Number 8 Region: 1901-1929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000175
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.09856
Sequence length 2835
Sequence
MVKVAGLAEILWISCLFSSISSALDPGEQAKVTTALDTAQFAINAINEEYIAQEKAINKA
LKVSTQTKSADLLKRQKELTNFGSKVGKALKAVQAASAIASFVFTFFMPSELDVITSLIN
KRFNEVNAKLDRIDEKLDEMEKSIKADTAFNVFLSAWIKWEYKARNGAKKLSDIRKVMGT
KTRRIDQVKLAEEYVKYYETNNFDGNVLNLYRMAALPEGLTQRNIFDRFIAQFGCDITKL
SELMILIKKIMTSAGQQKLTYYYFKGDQSRAKSSFKDIQMYFFKIRRAFDDRVWSCRRNS
LGYATRDAYKTLKNMRGSSRESIVEAIFKELKVKYPWYTWAVAAVKKERPRIRGLGLRGS
SYFRLKDPSDASKVYFVVYEDTRSSASCSDITQAKTLLVFKKCDGCNSDYIYAADNILTK
KRCRASTLERVVDFKHQCPRCHRRPYSTRCYCANRVKKAVKTWAFIASAVNTIKDICTSN
KCSSHGQCRQIPFTTTHQCICNRGYEGESCEKRLDFDDTIEKLIAELRKTFKVVNYVPTT
VDVFFSIRSLSQKLNVILQKIKTSFAHTNNIIQHSQTIYNVEDIADLYAKLQKNDMTFDQ
FGQRIDKYLKTVSTFKLQNRFKKMILGQGTLVTPGNDIYNSYKREYLSHNGGGCSAKYNE
DVKGFRDSLAYLDQALGEALLLHQIWLLETKGTTKILRTKYKKEAQYIQNIFKGRQLKYN
QYWKKYSCGSLSVDGAGVSCKAELSFEGMTVTLRCDKKRLATPRQVTCKKIGNVLKWDSQ
PKCKFVWGNFGGWSRCSKTCGGGFKRRYRSCLGTTNIQHCKRDKGGLNFQTASCETQDCC
SALYGKFKCSNGNCIWKSYLCDGDNDCGNNDDESKYRCRHYIRSGDWIALKSNAKTNQWL
SCYCTVNCGVDRCKLRGCPGSQMTGSDWNSCSSEAFVLYLTGYGNGEPVRSGDRIALYYG
AGHWLSCWGSGRVCPTRSCPGYGRWDSTDTRKCRGEMFWIYSPERQGRCSSDTRKSCRGK
PIQKGPNLASKLPSTNREFTDYMSGNFDKSFFFNPVMASEIETEILSISLNKAHGLYSCP
TRILRSVSPTTLLISECKDPFFHEITLTPTIPVRRNSMEKVLSVTFYLPKGLWLVNKEKC
SVQLEGTKSVTVKVGATCTTLYGLKKFSVITPKITNDPLESKFWGFFGLPTIWVTILQKN
QPLHKCMSVTDPHILVLHKVDGPQRWHDFYGHEEYLLYRNQERNFEVQTKQWACNRQGIT
CNCGVVIRDHNDLISFSCCGNPPKAHRDDFTPLSVDIPRKKCLAPGITITQLIKGFNTKY
EVIVPTGIKVIVERNYWGIDVTIYTPRAKHSQNEAGLCTYSGNDGDITHLAWKYRLTAST
SYFQTLPEEINKDARPFETSCACHETQDQALTTECEIDGIPVVSFIRDTTRTYNRIKMCD
NKPVKTQKIKDIEGSDDFTHEDLKDPMDLLKSNESLWEGTPVVSKDNATQYCAERLLETK
VGKLCAKLGTNVQALVNVCSADIEYTGDFSFAIGAVSVLINECQDLIIENMTVNTNETNN
ETKPAAMPPALEEVFRLLCPNDCTFNGKCVNGSCVCNKDYTADDCSISIYQRPTIKRIQS
DGLCDKRKRPCEKITIQGRDFLNSTNMTCHIREIEKNTCSINRYCFVPNEPNPSNWCQQC
IPEMSRNTWTKRQVNHPPNVTLESNYYVVYRENFKLPVEAVDPEGMPVTVSLLRGSPQKA
MIQNNVLYWNVTTNQTTQFFFKATDACQASSTFNMTLTVVPCPCNNSGQCVPQEPRGQRN
YSCQCPPGYTGQYCGTEIDECKSYPCLRGRCTDLLNNYSCSCYPGFEGRNCDVDKDIYIN
DCVNHTCENGAACLDGINSYACNCTTGFTGAYCETGVLPLDIDDCVNHTCANGASCVDGI
NNYSCNCLVSPRTLVISECTDPFFHNITLTPTIPVRGIFVSVTFYLPKGLWLVNKGKCSV
QLEGTKPVTVQVGATCTTLYGLKKFSVITPKITNNGNLGEGKFWAEFGLPTVWVIVLQKD
QPLHKCTSITDPHIRPLHKLTSPQGYHDFFGHEEYLLYRNKERNFEVIVPTGIKVIVERN
YWGIDVAIYTPRTKHSQDEEGLCTYSGNDGDITHLAGNYRPTASTSYFQTLPAEINIVAR
PFETSCACDETQDKALTTKCAIDGIPVDWPGPGKRYNRIKMCDRNPIKDRKRRDIEGSDE
LTHEDFEVLMTPLKSNEHHREKRSVVSKENATRYCAERLLETRVGKLCAKLGTNVQALFN
VCSADIEYTGDFSFAIGAVSMLMNECEDVVIENVTVNSKETNNVTTPTIPPALEKVLQLL
CPNDCTFNGKCVNGSCVCNKDYTADDCSISIYQRPTITRIQSRGLCDRRKRPCEKTTVQG
RDFLNSSNIACHIREIEIANSSWIPNGNETKYQGTMTDLVLVECVLPSLPVLRMRYHETI
EGIPAAGLMISVSNNGIDKSSQELKMISFDSVCMDCNVSAGCTLKSDASTRVGRCTDLLN
NYSCSCYLGFEGRNCDVDIDYCESSPCVNGSCTDGVNDFECACRAGFSGLRCEEDINECL
QVSCGNGNCLDRINDFSCVCNVGYTGRHCDVIITKCSNGSCYPGVPCMDKTVPISCGPCP
SGFTGNGKNCKDIPFLPSTSSPKTVSSPKITATRRRNELEYTKSYKIKLMANWNDELKDN
NSEAFKDLKIVLEEEVMCSETELVISFYFNTILKKPTMTVPTEKDVTYAITIGVSLGGLF
VVVLCIIFFVRLCNNRNAAHRGNPASDKKPPGKAFPVSEEYELKSVAVNNACVSVGEVSL
GCDEQKTGFSNEGFQ
Download sequence
Identical sequences adi_v1.09856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]