SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.09968 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.09968
Domain Number 1 Region: 2100-2260
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-49
Family MAM domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1481-1641
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-48
Family MAM domain 0.00042
Further Details:      
 
Domain Number 3 Region: 1939-2097
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-48
Family MAM domain 0.00059
Further Details:      
 
Domain Number 4 Region: 3505-3670
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-46
Family MAM domain 0.00064
Further Details:      
 
Domain Number 5 Region: 522-682
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-45
Family MAM domain 0.0014
Further Details:      
 
Domain Number 6 Region: 850-1017
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-44
Family MAM domain 0.00054
Further Details:      
 
Domain Number 7 Region: 3674-3836
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-44
Family MAM domain 0.0004
Further Details:      
 
Domain Number 8 Region: 2711-2876
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-44
Family MAM domain 0.00067
Further Details:      
 
Domain Number 9 Region: 2898-3059
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-44
Family MAM domain 0.0012
Further Details:      
 
Domain Number 10 Region: 4616-4777
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-43
Family MAM domain 0.00091
Further Details:      
 
Domain Number 11 Region: 3064-3223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-43
Family MAM domain 0.0007
Further Details:      
 
Domain Number 12 Region: 3226-3393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-42
Family MAM domain 0.0005
Further Details:      
 
Domain Number 13 Region: 1742-1905
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-41
Family MAM domain 0.00069
Further Details:      
 
Domain Number 14 Region: 686-847
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-41
Family MAM domain 0.00037
Further Details:      
 
Domain Number 15 Region: 4255-4416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-41
Family MAM domain 0.0014
Further Details:      
 
Domain Number 16 Region: 3838-4006
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-40
Family MAM domain 0.001
Further Details:      
 
Domain Number 17 Region: 4052-4210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-39
Family MAM domain 0.0012
Further Details:      
 
Domain Number 18 Region: 332-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-38
Family MAM domain 0.0009
Further Details:      
 
Domain Number 19 Region: 2437-2567
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-32
Family MAM domain 0.00053
Further Details:      
 
Domain Number 20 Region: 1229-1346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-29
Family MAM domain 0.001
Further Details:      
 
Domain Number 21 Region: 2568-2683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-28
Family MAM domain 0.0033
Further Details:      
 
Domain Number 22 Region: 215-329
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-20
Family MAM domain 0.0016
Further Details:      
 
Domain Number 23 Region: 65-118
Classification Level Classification E-value
Superfamily Kringle-like 1.06e-16
Family Fibronectin type II module 0.0011
Further Details:      
 
Domain Number 24 Region: 1349-1451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000174
Family MAM domain 0.0041
Further Details:      
 
Domain Number 25 Region: 3444-3488
Classification Level Classification E-value
Superfamily Trefoil 0.00000000000275
Family Trefoil 0.00073
Further Details:      
 
Domain Number 26 Region: 2357-2434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000144
Family MAM domain 0.012
Further Details:      
 
Domain Number 27 Region: 4434-4473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 28 Region: 4794-4834
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 29 Region: 1097-1227
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000297
Family Ricin B-like 0.022
Further Details:      
 
Domain Number 30 Region: 4472-4567
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000038
Family MAM domain 0.031
Further Details:      
 
Domain Number 31 Region: 2262-2344
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000038
Family MAM domain 0.012
Further Details:      
 
Domain Number 32 Region: 3394-3442
Classification Level Classification E-value
Superfamily Trefoil 0.000000301
Family Trefoil 0.0024
Further Details:      
 
Domain Number 33 Region: 4573-4611
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 34 Region: 1047-1103
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000918
Family MAM domain 0.01
Further Details:      
 
Domain Number 35 Region: 1646-1740
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000981
Family MAM domain 0.0076
Further Details:      
 
Domain Number 36 Region: 4219-4252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000012
Family LDL receptor-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  adi_v1.09968
Domain Number - Region: 4016-4052
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000109
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.09968
Sequence length 4846
Sequence
MGGKLLPVFLALITGAIAQDCDFEKSLCNYKQDPSDNYDWSWGAHGKNTSAGSGPTSDHT
TKDSKIHTIAGNSNGAPCVFPFTYQRRTYTECTNTNHNLLWCATTSNYSADRRWGNCVPN
SVYAIGCYQMTNSTFQQSFSSPLTGPNVIQQCLNLTKGYQGFGLRKLQTQPYETFGCYAD
DNAENKYNEHGPAPFCGREQLGIVNSNATAVFLFSGRYAYVGAKPTNAQVARLVSPLISV
SLATTKCLSFWYNMYGPSVGSLNVYAKTSSLGSPIWSRNGTQGNQWHQAIDLEIQKNQSF
SLVFESNKNGAILKEYIAVDDIKLKDGPCSTPGECDFQKDFCTWTNLRGDQFDWTRRSGR
TPSSGTGPDRDRLGTTSGYYIFIETSYPRSPGDKARLLSQKFNGTNTKSCFTFWYHMYGS
HIGALNLYEQVGSKETLIWRLSGNKGNNWYSGQVAVGNIAGYKIITEGVRGFSFQGDIAI
DDFKIFSGVSCQITPLSASPNAPTTSAPLTTAGATTTPPPNVGINCNFDFGFCTWKQDTN
DQFDWSRQRGSTASSSTGPSADHTTGNGYYIHIEASWPRRRNDIARLISAQVPATTGSNG
KCLSFWYHMYGANVNTLSVYVRTGSHDTLLWSKSGTRGDKWIKALVSVTSRSPFKIVMAA
SVGRSYQGDIALDDISMSSGACKVSSTTCTFEESHMCGYTQDTKIDNFDWRRGSGASITP
NTGPSADHTLGSPAGFYMYIDSSSQRSGYIARLLSPPMQRTRAKCLQFWYHMYGSTVGSL
SVYKLVTPTRGPQIWRMSGNLGDEWLVAQVSVWSPLRSYNIAFQARVGNGSNGDIAIDDV
VVFNGRCASPGNCDFERGTCTWRNTRKQDDFDWLQGKGNTLSLTTGPSTDHTTNSANGTY
MFIEASSPRRFNDKARLTSQQFSPVSVRGRCLKFWYHMLGADIGTLKVIQKTGPGNRSEI
LLWTLSGQQGNTWLNARVSLSKSPNRNYWIVFEGVRGNGYRGDIAIDDIQFTNADCTILP
AKARPSKPTSPPPTTRFTLPPTIPPSLYNCDFENGFCNYTQERITDIFNWTRHQGGTSSS
GTGPVMDHTKQQGVVVGPNGPGSLQQLRTGKCVHVFLGGFRKPPAGHSVVFHDGCGEDRL
EFQLTSDGYMKFTKFNMCWRRRGGPGSNADDVVLDDLCTEKWRFTSAKSIQHIGTTKCVA
PHLGSAVNNRKLVLSSSCDQRNQIFRWQPTRGWYIYIETSWPRQPNDTARIHSPNITSAP
SQQRCLSFWYHMYGRHIASLNVYTKVGNTFNGPVWSKSGTQGNKWWNGRVPVSNLNAYQI
VFEGVRGSSYQGDIALDDIELLNSACPATMNCDFESPLSQLKMCGWTQRSDDNFDWRLGL
GATSSINTGPSNDHTLGNQKGHYLFIETSIVRQGSKAWLQGPQISPQSGIRGNSYRGDIA
IDDITYTVGSCVTLPRGAVPTAPPTTVRPTTSPTVPPKGALDCDFERGFCSWVQDSSDKF
NWTRQRGATPSSNTGPSADHTLKNATGYYAYIEASLPRGANDTARLISPLIPANSRPGMC
ISFWYHMYGPHIDTLNVYTKVGSSLGSAIWKKTGNQGNQWRYGQVFVRTILNFQIVFEGV
RGRSYQGDIAIDDVAVRNGFCPPLKQCTFEDPGMCGWRHENRYALDREPGLSCLKWMEHI
LGVHYVVLFKDFRIKNYPLENIMVTIRSVSQFQVVFEGIRGSGYQGDIAIDDVELKDNVC
PPPGDCNFETGTCNWVNVQNTDNFDWLRSRGSTLSSFTGPSVDHTTNSSSGYYMFIETSN
PRRNGDKARFESEEFQPTGSSGRCLKFWYHMYGSSIGGLNVWMSSNGSTGQIWTLSGNQR
QDKWFYAQAPVRSANVYQVIFEGVRGLSYTGDIAIDDVQFIVGNCPVLPSKARPLNPWTP
RPVSTVAPTNSTTPAPSIYDCTFEQSMCTWTQALDDSFNWTRTKGRTPSRFTGPVSDHTT
GGSAGYYVYIETSSPRIANETARIESVTIPATQQKCLQFWYHMYGPHVDTLNVYTKINNQ
LGVPVWTLSGTQGNKWRHAVVSLTVSTKFKVVFEGRRGVSWAGDIALDDISFQDGQCPVQ
MQCSFENPNLCGWSNVPGDNFDWTRSNGYTSSSGTGPSVDHTSGTSNGYYMYIETSSPRS
RGDKAWFVSSPFKATNGRCLQFWYHMYGATIGALNVLLLQNRTRSAPIWNLSGNQGNLWR
MAQVTLKSPTDFKVIFEGVTGTSYTGDIAIDDVEIMDGACPLPGDCTFEKGTCTWVNSLN
VVDDEFDWTRGSGGTPSSFTGPSTDHTTGTRNVHVPTLQQIILEGVRGSSYQGDIAIDDI
SFVATARRCRLSPSNAVPFDCNFELGTCSWTQSLNDQFHWTRHQGSTGSFLTGPSIDHTT
ATNKGWYIVFEGVRGVSYRGDIALDDISLKDGSCPSSGMCSFEAPDICGYTQDHDTDQFD
WSRSNGPTASFSTGPAADHTYGTLFGHFMYTEVSPSSITQGSKARLLSPRYPATRGSCLQ
FWYHMYGQTIGTLNVYTRRSSWSLNKVWSKTGNDTNIWNVAQVTIRRQGYYMYIETSVPR
RPNDTAGLVSPKVQKVGSFACVIFWYHMFGPHINQLNVYFKDGSKAKTLMWQKIGSQADE
WRQGLLQLSPSQGSYQVIFEGVRGTSYQGDISLDDISFQNNKCPSSSIAGRSFRGDIAID
DLKLIKSPCPLPGDCDFESGMCTYDNTQTEDQFDWLRNAGATPSWRTGPSVDHTLGTGFG
HYMYIETSSPRRQGDKARLMSEDFNPTTSSGRCVRFWYHLYGNAIGTLRVLVKTGPGNQS
ETAIWELSGNFGNQWYSAQAPVSSAKVYQVVFEGVRGRGVSGDIAIDDITFATTRCSVVP
SLAVPPTPPPTTPPPVINNCTFEGGFCSWKNLRGDNFDWTRSRGATSSWRTGPTTDHTLG
TRAGYYVYIETSFPRRSRDKAWLQSGLIQPTTVTNGRCLKFWYHMWGTHVDTLNVYRKVG
SSPNVRIWFRRGTQGNKWRFAQVNLLSNQPFYVIFEGVRGLSYQGDIALDDLDIADGPCP
PLTVCDFETDMCKWTNIAIGDQFDWKRDSGGTPSAGTGPSRDHTTGTRNGMYMYIETSLP
RRQGDKAYFISPRYDAAPNGKCFKFWYHMYGRHIGKLNIYVKAGPALGAMVWNETGNQGN
FWLHGKAPVKISTRFQIVIEGIRGASYAGDIALDDFSLDDSPCPPEGSCDFEEKSFCSWL
NVPNGNKSLGLDDFDWTLGSGSTPSWQTGPSTDHTTGSSLGTYAFIETSNPRQTGHIARI
RSKTFSATNGKCMSWWFHMYGSSVGSLNVYIKKGGSPESLLWNTIGNQGNVWKKTEVTIT
SKSDFQIIFEGVSGAGFQGDIAIDDIDFADKYCVGLCSSVNPQQRVDCSGGLGISRTTCV
NLRRCCWDDSVPNVPVCFYHPSACASVIPANRRTCGFSGISSSQCRTRGCCWDNSLSNVP
WCFHGPARPTDFPTQPPPPTTLPPSKWDCTFESGFCNWNNSQEDDFNWSRQSGGSPSIGT
GPTSDHTTGSLRGYYVYIETSSVSANDTAVLESAMVPATIRKPSGMICLQFWYHMHGQHV
DTLNVFVKPGNQLPSSPTWTKSGTQGTQWRLGQVAVSSRAPFQFVFQGIRGKGYQGDIAL
DDIRVLDGTCPPSRECDFESPNLCNFTQDTGDIFDWSRGSGNTISVGTGPSYDHTYKTAS
GYYMYIETSAPRRTGDYARIESISYDQTVGNGRCLVFWHHMYGGGIGRLNVYIKRGNSLG
TPVWRKNGNHGNKWWRAMVTVRSPNQKWKVVFEGIRGRGGRGDIAIDDIIVKDQPCPPPG
SCDFESGWCAYQNDFTGDDFDWERNTGHTSSTGTGPSVDHTTGSPQGHYVYIESSYPRTK
GDVARLTSDLFEVSKGYAWCLSFWYHMYGNSVGSLSVKITIYPFRKDKPYTRLLWTQQLN
HGDVWLTDTVQINSPDDFEIVFEAVVGSSYDADIAIDDIVVTAGVCPSPKPTVAPNPCAV
RCKSNNRCVSSTQLCDFVNDCGRGDNSDEKNCGACTFEQDLCGWNDTSKGAFKWNKDRGG
TPSSNTGPTIDHTLGTALGYYMYVEASQGRIRDMAQLESPWLKQSASTCVVSFWYHMYGR
GIGTLYGYIKVGLTYTRLFEQSGNKGNNWLQGKLYVGRRFAPFKIIFEAARSYSVFGDVA
VDDVSFVNCTLPPIVSSCGQQHRCIRGSCIDRGRVCDYTDDCGDNSDEQNCYNFKYRCSF
EKSLCQWTQLKDEEFDWKRNQGVTASYNTGPMFDHTLGTAAGYYLYAEASYPRRKGDKAR
LASGFITTPGDDSCKLRLYFHMFGSGIGSLNIYTRPCNGCAETLVYTRSGNLGNFWERAE
VAFMSRVPFQVIIESVRGVSYLGDIAIDDLSMTSSCQNYRGPLPTAPPPTTAIPTPPPCP
GSQFKCSNGLCIDTWKVCNYRDDCGDGSDEVNCGSCSFEPGLCGYQDVSLTLYQWSRNRG
ATVVPQTGPSVDHTCGNASFYGNNGDKWKRAEVGLGSLDAGFSIQFVASKFVTAADIAVD
DVTFLGCALPPIRSCISGEYRCTRGSCVLPSQVCDFSDDCGDMSDENRSTCASYKERCDF
EQDLCSWTQDTDDDFDWTKDSGGTPSSWTGPGRDHTKGSSEGFYMYIETSSPRKSNESAR
MSSMTFRPSSRNDSCYMRFWYHMFGKDVDTLSIKLRISMIGPLIPLWNRTGEQGDMWRRA
EIHLASNVNFQVVIEGLSGPGFQGDIAIDDVSFTPNCRPDSTASISTTIPTGPPIPGCQP
GKFKCANGGNCISVSKVCNFYSDCPGGSDEMNCPATYPLTVHWTIC
Download sequence
Identical sequences adi_v1.09968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]