SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.09969 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.09969
Domain Number 1 Region: 587-745
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-46
Family MAM domain 0.00051
Further Details:      
 
Domain Number 2 Region: 790-953
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-42
Family MAM domain 0.00046
Further Details:      
 
Domain Number 3 Region: 1233-1396
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-41
Family MAM domain 0.00032
Further Details:      
 
Domain Number 4 Region: 163-320
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-40
Family MAM domain 0.0025
Further Details:      
 
Domain Number 5 Region: 370-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.17e-40
Family MAM domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1458-1620
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-37
Family MAM domain 0.0019
Further Details:      
 
Domain Number 7 Region: 1670-1829
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-37
Family MAM domain 0.00065
Further Details:      
 
Domain Number 8 Region: 2271-2429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-36
Family MAM domain 0.0041
Further Details:      
 
Domain Number 9 Region: 1017-1183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-36
Family MAM domain 0.0014
Further Details:      
 
Domain Number 10 Region: 1895-2054
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-36
Family MAM domain 0.0018
Further Details:      
 
Domain Number 11 Region: 1-110
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-29
Family MAM domain 0.0038
Further Details:      
 
Domain Number 12 Region: 2072-2243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-24
Family MAM domain 0.027
Further Details:      
 
Domain Number 13 Region: 2729-2763
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 14 Region: 2883-2925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000978
Family EGF-type module 0.016
Further Details:      
 
Domain Number 15 Region: 1843-1882
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000105
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 1422-1458
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 17 Region: 329-364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000772
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 18 Region: 2636-2712
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000013
Family MAM domain 0.02
Further Details:      
 
Domain Number 19 Region: 547-588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 754-787
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 21 Region: 974-1017
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 22 Region: 1626-1664
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 23 Region: 1189-1228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 2772-2821
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 25 Region: 124-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000681
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  adi_v1.09969
Domain Number - Region: 2810-2844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 2848-2877
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0183
Family LDL receptor-like module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.09969
Sequence length 2963
Sequence
MYIEASSPRKPGDSAILGSAVFKPTSSCKLRFFYHMYGSHIGHLNVSIRTSTNGPSTVLW
TKSGDQGDKWTRATVSISVSQNFQVLIEGVVGSSYRGDIAIDDISFTPDCVVGGTIPGLP
TPTPTPTQPSCFNCRDGSACVNISKTCDFHNDCPDNSDEDADLCGWPCDFQRGTCSWTNS
NRDNFDWTRHKGCTASISTGPCYDADNRTSGYYMYIETSTGLSGNKAVLVSPRYQQAYST
AQLSFWYHMYGRTIGRLSVYLNDGINRTRMWTLFGNQGNKWYQTFISLGRRRTPFTIEFE
ALRGSSWSGDIAIDSISMNNYALTYCSGQLPPTKWRCRNGACVDANALCDFSDDCGDNSD
EQSCSNYFSRCTFENGLCDWLQGSGDEIDWIRNKGPTPSFSTGPSRDHTLGTVEGYYLYM
EATGQRFGDRARLASNNLMGRCNLRMFYHMHGIHVNSLVVYMRTKLNGPLRVVANMSGSV
GDNWIRSEVNVTNGDQPFQIVIEGIRGRGYRGDIAIDDLSIAMKPSCQQFFGSLPWLGST
VKPITTVAPNNCVLPQVPCVSDGKCISSSQVCDFNLDCADASDERSCPHMCTFESDQCGW
VNTVKDNFDWSRKRGRTPSFGTGPSVDHTTGTNQGYYMYIETSYGRIGDRARLISPQFKK
SHSNCKMVFWYHMYGSSIGSLSVYLNVSSNTKLWWRKYGYQGNQWHKGVVGIGKRSNAFQ
VIFLGIRGRSYSGDIAIDDIKFVDCALPPVARSCPSQFTCARNSCVSNDYVCDFNDDCGD
GSDETLCGAYTTRCDFSRGSCDWTQSNEDDFNWLRRKGATTSFNTGPPSDHTSQTGYYMY
IETSWPRRYGDKAWLVSRNFQEMTPGSESCKLRFFYHMFGDSAESLNVYIRTYRNGSALQ
RVWGVKGSQGAIWNRAVITLSSRKNFQVLIEGIRGDSYTGDIGIDDVSFTTGCKQFSGNL
PVAPPISPTSNPATTIPHQCTTAEFNCFNQGSGACIPSTQVCNFQPNCNDGLDEQNCAKT
KCSFDGGDFCNWYVNNPSRTRRAVAYTWLAQQGATGSSGTGPTKDHTTGTLSGWYIYAES
SGGSNDDRAPLTTPLIGQTGPECTLLFWYHMFGVSVGTLSVKLSFLDGTQSVMWSKSGSQ
GNRWRQSKLMIGSRQLFKVTFEARRSYGYKGDIALDDIEFLNCVPLDLTKRCTADEFQCA
RGGCIPKTSVCDFKADCMVGDVSDESSCSAYRSGQCDFEHGLCLYSQSSDDKFDWTVKTG
GTFSYNTGPTIDHTTKSKKGHYMYIETSWPRRNGDNARLNSPILKSTSSNCYLRFFYHMK
GSHIGNLSVFSRTGYSVGDLSGPLLNITGAQGDFWNRSMVKAPVSSNDFQFVIEGVRGNG
YQGDIAIDDVSLTPGCQICTDCTLPGQPTSTPFGFHTRPTGTPCSLQQYACKNLRCVDKA
QICNFKDDCGDNSDELPCGSNCTFEGDCYKGWRQSTGSSNFNWRRRNGKTPSVGTGPTND
HTFGNQNGYYMYIETSNGSPGDKAELASYRYFASSPNCRMSLWYHMFGTGVGSLQVKLKK
SDGTYEILGNALSGSQGNAWKKYTLNIGANKNFEILIVAARGINWQGDIAIDDISFTDNC
FVDLNRTCTPNEVKCRTSGHCVAEQRVCDHVKDCNDGTDEDALICSNRTASCDFNVNWCQ
WDNYWYDDFNWLRASAIGTPNTGPRADHTTGKGYFLYIDSSKPRQLFDKARLVHPNVFPS
GRGVCTLRFYYNMYGSQNMGYLSVYLVYSGYSRWTRVWRTRGDPANRLWVRAEIQLNSQS
SFRVGFEGIVGGGDKTDIALDDISFSAGCYKGGSPPLPTGSARCSKVQFYCNADDLCINI
HWKCDGERDCTDGADELLCPSPTKQPTPPSGLTHPANCNFESGFCLWKSATFADMKWLRN
SGQTPSRQTGPDGDHTTGTGYYVYAEATGHYMNQFGELLGPNMMPSSTCKVYFCYLMHGK
DMGTLNVYQRFPSDKKPDQTQKRKWSQSLDFGKKWRCVYVPLPSTRQFSVVFEAIRGKGY
RSDIALDDIKFVNCARLGPTQKPTPAPRGTILDEDFEDCISCWMNEKNGHDQMDWVIGRG
ETSSLNTGPSYDHTRKTIYGRYLYINVYSASHIQGWVHADLESRLMVVQRRCYMTFWYHM
YGAGTGSLWIVAYVYDDPKNLNDWREVSLWYSYGNQGNKWTSGKVNLFNYLTANKTSRVV
ISGIRGSDYTGDIAIDDIKFHNCDFKDDKTPCGEVFDRCNDRPIPKPTLGPASGDCTFES
GLCHWNNTIVNDMPWFLRKGKTGSQNTGPAVDHTLGTPDGYYVHIEASWYTMGSVAILEG
PYTLPTQNCEMKFYYHMFGGDCGSLLVYINSGDSVKLVFNKTGEQGRDWLGATVQLKSDY
AFRIHITATRGSSYKGDIAIDDISFRGQCQFTSNAALRYGDKLLTTGCADGGREGFFSHP
SVAGCKGRWSRPKSLRAKPTSGAKCGDDIGLWGRSCSQPAELCATGWHICGSYGVREIVN
RTNGIDCQEAGYGKFSAGINHCMQNNGGGDGCKRVVTDIDYGCGKFHDSCSEPLCCGSNC
QGPDICDSGVFRRATRYSASSDDLQGCSFISSDNAGGIMCCKDDATTPTPAPTMSPVPGS
CNFETGLCGWIVDSSTALSFVLGQGETVTRNTGPRYDNTKKDMTGTYLYLPAVNGKPNDI
ARVSHHFSNVTQQRVIGLIWRLETDVKPGKCNRGQFSCLNGECIKSIFVCDKVADCADHS
DEGSLAECPNANCSNLQIYCPADKKCLNKTLQCNNKVDCSDGSDEFHCQCTEEFCINGRC
LLDALHRPSCVCNDNYAGRRCEQCTNCHCETNQIQCKVGKWFCTEKSQVCGKQVDCGLSP
PKFVNLCNACTDDYCLNGGTCAKDTQGNPLCRCPPKYTGKRCEKLACPQLQVPCQKTCVN
ITDFCDNKMSCGYTATEVQNYCG
Download sequence
Identical sequences adi_v1.09969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]