SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.10945 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.10945
Domain Number 1 Region: 163-317
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-34
Family MAM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 60-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 3 Region: 97-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 375-409
Classification Level Classification E-value
Superfamily Kringle-like 0.0000485
Family Fibronectin type II module 0.007
Further Details:      
 
Weak hits

Sequence:  adi_v1.10945
Domain Number - Region: 483-552
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00095
Family Pentraxin (pentaxin) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.10945
Sequence length 555
Sequence
FPQQKSNEIFLSKCHLYRMEMLMKEDAWSDSASVGIRLPNGSYERPIGNNRLFWVLPGFT
CNFQDEFQCGNGPCVSKDLVCDGDSDCLDNSDESDCTCSAAKFACPSGECISIENLCDSK
SNCQDGTDESRCGPTNCSLLNVDCALSNNTGPIDRQKCPSNKVKCHFEDGFCGMKHVSKP
YRWQIGSGSTPTKFTGPRFDHTTLLPSGKYIFIESSDYETSSVAAVLASGVVDSSERTCI
QFWYHMRGREIGILNVYIRTNETRTLIWQLAGDQGDNWNFGQVGYKGDSPYEILLEAVFG
KGIHGDIAVDDLYFSNEEDCPTTYGNESPNCLFEMNHCAWRASNNWKISQVHPPTPKRQD
WQASNGPTRAKCPIRRTENGGCCDFPFVYKNSKHNTCIRENAQYSWCQEASFSRQQSKCA
AFDSCSVFYKGICGWLNSDLGASPWRQVMRQETERVSRIVNSLLKQEGWNPSAGFSEESN
FQLEFPSNHISYVNMTDLPDLSEFTICFWMKTSDKTSAGTPLWYRVRYVNKKEYITAIAL
IDYQGFYVYIGDTKS
Download sequence
Identical sequences adi_v1.10945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]