SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.11691 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.11691
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.7e-34
Family Tubulin, GTPase domain 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.11691
Sequence length 96
Sequence
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGKYK
Download sequence
Identical sequences adi_v1.11691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]