SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.11736 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.11736
Domain Number 1 Region: 454-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 575-614
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000681
Family LDL receptor-like module 0.0034
Further Details:      
 
Weak hits

Sequence:  adi_v1.11736
Domain Number - Region: 373-425
Classification Level Classification E-value
Superfamily FnI-like domain 0.000115
Family Fibronectin type I module 0.021
Further Details:      
 
Domain Number - Region: 328-369
Classification Level Classification E-value
Superfamily FnI-like domain 0.00335
Family Fibronectin type I module 0.028
Further Details:      
 
Domain Number - Region: 504-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0385
Family Cripto EGF-like domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.11736
Sequence length 930
Sequence
MLNQLCRIILILIFNLLKTLASIGNECANFTTLTEASRSRYFSSYWTTYSDRSLTGWFRL
NGSAGSHIATSCVPSRHCGTLRPGWMRGKHPNAERGVVGRFLCLTNRQLCCSMSVRLLVR
NCNGFYVYKLNKVPRSLSRNFRVCGNGLEGASLSSRKVHIKISENIAQECVNYSELNELD
RAAHYFSYHTLKCDANLPGAWYRFTGRAGTVMPTKCVPKLHCGTLSPGWLNGKHPAVREG
QVERMVCFTKEDKCCYWYSSVKVRNCGKYFVYKFGQLPASRPFCSLRYCGAGTQGCKDKV
GNIYEVNMSWKPNPLITCNCGRDLRVSCRKTQVGCWSIEGKAYRNRQKWLKNSLTMCTCV
NKQIACTNLSRPACTDVNGVVRPHGNQWFQGACFNCTCIDGVVSCVKYHVAISYGLFKAK
AVGTCMPCHRPWEDIRPADKGTISNCEVFFQLKKTNKLFQCTNGAFIRKEHTCNGITECG
DGSDENSCGNVICRDESGQVLILRHTWQVTKCIRCKCVAGLLQCQRTLGVNFVGKLYAYF
PLTEKCNQPACNVVNFLRDRRDGCEGIRELRLISDKQLFLCESGDEITSLNNRCNKENDC
VDDSDEKDCDRYYCPSHKKFNLAWNRSASGTVVHRKCSEVDPVLEGQFSGRCEEFPTYLQ
WKYKERCDCEIEALRRFRSELTTVNKSNLLEVTKELLSEARNFTNKRVFFSYLKNLFEIG
QLLLTPISDQNDQQAHDFCQAITKAVIDDNFNTDADVFCSGHVKSSWRRTLFEKVKKFSC
QAPNWTSVYQSSCLSSPSFSDSEPLLSVVDRHDSPTYIDPRPGITLFWVRPVLNLKIDYN
QLHPAEIGVPRQDSTSFQITNGSGVVFCCSCIFTLQIRRKGKSHTERKTCDLEQPENGFH
ESVLGVGFTMANGCTRDQFLQFSWSMSSSS
Download sequence
Identical sequences adi_v1.11736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]