SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.12068 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.12068
Domain Number 1 Region: 175-278
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000101
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 2 Region: 68-121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000351
Family Complement control module/SCR domain 0.0057
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000641
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.12068
Sequence length 390
Sequence
MIIFRLWYALFLMHGTALLSQGLRNSKRSFPSRPKRLVTSMNNTCSTHRLLQEYLPVGAI
LKDGSNLTGNFSFFVGEKAEFLCKAGYREVGKLHSFICQEDSSWKMSSKQQSGLCVTKQC
QFDTFSCKNGKTKIDACQQCDCIAQCSDLSDEAFCAPTVVDITGKTKGTLMPSTPHRNPN
KPNTTCSSWRLETDDQGFHIKLLFERFSLFPNCTRNFVALQNVDFVDPTRTAQCCGESRN
TGRVCKFGGKTPPPLSLSRTNHMTVLFFSDTGYSSFTASWFNVHRSRAILSEDATHAVTI
KLRTTEKDKLVPGSDSFTLALILFILLLFALSCFVGCKLGKRYLGPVCSFRYLVACILCR
PTPAYFRASALSDDLERRSLTEEVHLTTFD
Download sequence
Identical sequences XP_015754816.1.88439 adi_v1.12068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]