SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.12616 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.12616
Domain Number 1 Region: 253-430
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-27
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 86-246
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-21
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 3 Region: 5-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 46-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.12616
Sequence length 445
Sequence
TTARPFCSSSEYQCAYGGCVPRYSVCDGISECYDGSDEVGCATPSPCTGFTCDRNRCLSS
SKICDGIPDCQDGVDEKHCNDSLKVKNVRVRNINSTSVTVQWNPITVHPANVTFPGYRVS
HRSVSLHNVHDVGAWQWFDTGLVTSASVSGLQPCSEYEFRVQVLLQGLAPGPYSDVVQSL
TTFFPVTASAPRNVQHLLNGRDSVLLTWEAPATYCSVITNYKVLFRIHGPGDFTPVEVGN
VLSYRLRLSGGLPVSNLQQSTGNETSVSLSWGPPKDSSGAVVPVSGYLIYQNDVGLIGNT
SNHNFTVTALRSMTKYTFTVKPYNSAGVGPPYIIEVTTTGVSAPTNVVAKPYNRTVVSLS
WSPPQHASQAQSNYYYIFYGTVRSGVSAVAVGRTSERTYMVANLHPDIDYLFEVSLGTSG
PHSRPVSSRTKTGLYVCLSKSSLSS
Download sequence
Identical sequences adi_v1.12616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]