SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.13292 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.13292
Domain Number 1 Region: 11-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-27
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 544-652
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-19
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0024
Further Details:      
 
Domain Number 3 Region: 473-543
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.25e-16
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0048
Further Details:      
 
Domain Number 4 Region: 243-340
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000122
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.012
Further Details:      
 
Weak hits

Sequence:  adi_v1.13292
Domain Number - Region: 192-259
Classification Level Classification E-value
Superfamily Sialidases 0.0785
Family Endo-alpha-sialidase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.13292
Sequence length 666
Sequence
MCFDSLFLAICISPLGLESGEIKDEALSHSLPSSHESKPSFIRLNGDVSRYPFGWQARIA
QTPPDYLQIDFGSLRKVTRIATMGAFRVTSLFVTTFKLEYSRNGLTWEKYRENGQVKDIK
GPQNQYESKFPVLAKLAEPFVSRYVRIIPNDALKSMRAEIYGCFVEQLPPYTDVPEYARR
SFLLDPVTDRFFACMYTDDQTESSCFSTVDGVEWIAVKPLIISIIACSPIWKEIYGLDRR
MNFHRSCDSGETWRQITDGYVKEVREEPNLVRAKSLPENLVSQNPSTNFIVTANSTGITW
GVSGAGIHIMTIGDHSWSMGEPKLHLKVSRSLSDNAAMTHGSTYDYGFVVSHDPASRAHA
LGVHVTWMLTPFVKFHKVTSFQHIGSYRVEQKDDSVTFKIGEIPWMSVANLTFSVMFDSQ
RSLDTGKHYIVTPVHLLYYKEYSENPPGHVISKGDPYSSPLQKVAVEVEIPGCTGALGMA
SGEIKDYQLTASSSYSEAPPTQARAADGNDAWCAVTTDKQQYIQVDFTRKTRLTRVETYG
RMNCIYPLGLESGYIPDEALTQGFHQSNPTNIRLNKVITEFPFGWQALQDALGRVDYLQV
DFGSLRKVTRIATQGSGGVTSFFIKTFKIKFSNDSMDWKEYSENGKPREKCFARSGHWMF
VRLYVY
Download sequence
Identical sequences adi_v1.13292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]