SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.13503 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  adi_v1.13503
Domain Number - Region: 43-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00641
Family LDL receptor-like module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.13503
Sequence length 87
Sequence
MAGKVLLLLLLLSVVTLVTCKPRDQSFRRLFNKGTPAENDNSDSVPCLGVCSSYINCLHG
SDEFGESFFIKGSCAPPLHCCTYVPFK
Download sequence
Identical sequences adi_v1.13503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]