SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.14928 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  adi_v1.14928
Domain Number - Region: 230-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0838
Family LDL receptor-like module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.14928
Sequence length 266
Sequence
MAKPSLGHIIKVRRQSFIPSYFSVCESQLSWNNEDCEYELQQAADSEVSGARFYWLRSET
FSSQNQLFTTSYLTMPLTKMTEDSEQSGTTLTTRLLSSGLAKRFSCNVSKMAYRVRNRTV
CDGYYGCPDEKFCTGKGHTTSLKRGKPVCILPWKKRKISSKAKKPKKAVKSSKGSEKESD
GFTSLLEKTKVTNNNTKGHVIKDEQGNGTKCHPAMFYSYYIAKGNAVQYRQICAPKRRPC
DGFYGCYDEGSIRGKKAGKRKLINKY
Download sequence
Identical sequences adi_v1.14928 XP_015750255.1.88439 XP_015771661.1.88439 XP_015771662.1.88439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]