SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.15553 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.15553
Domain Number 1 Region: 181-216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000294
Family LDL receptor-like module 0.0036
Further Details:      
 
Weak hits

Sequence:  adi_v1.15553
Domain Number - Region: 431-680
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0011
Family Rhodopsin-like 0.034
Further Details:      
 
Domain Number - Region: 36-76
Classification Level Classification E-value
Superfamily FnI-like domain 0.00314
Family Fibronectin type I module 0.07
Further Details:      
 
Domain Number - Region: 210-252
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0549
Family Hormone receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.15553
Sequence length 684
Sequence
MRGNLSFCANGRQVASKNSDCKDTSNCLQNINIQNCSSEVTCQDEDDNQYFEGTTWSVGS
CMQCTCISGIIRCSREVSLVKFLELTPLEDQPSFTVFTEWCNQPECNVAKYMEKNAGVCH
ACRWNDKIYYDGDDWKENGVDFFCAKSSHESHRVRSGCYVESRRVKCTGAITGIRQLSLI
SNHQLFLCDSGDEIRPISDICNTRADCEDFSDERNCENYYCSYETAHGFLWNRTQLGQQV
LKECSLSFIDTMFRSPQYSVKDTFCKAELAEERNSLIDKALGFLRQAPNQTEAHRVGWGP
NKWPVYVTVTQVVDNFLGIISMKLNGIGKRLLFLQLNTAPLVSPIVEKKTTPRDPAREKN
VTSKNDTNQNTTGTIHNDSTRDPTIKQVNDLLRANNCTELTYEEEKDVFIFKKGVSAEEL
KHEQVQSDMEIVLLCISIAATILALVLLTVLRLKNSERLFIHKSLLFSLGVGNLVFVLDK
TLFASREDHPALCSAVAVIQHYLHTAVFIWMLVEGINLYIKLVKVFSVKELYAMYLAIGW
GVPAIIVGLVTSIRPSTFDMAESETTEITCGALNLTVTKQRTRCWMNGNLWIYKGPILAI
LLVNLVLFAILLRVIFGKISSKYGNNHVILAKGIRSIIAILPLLGVTWLLGFFIEFHYIL
IYLFILLNSTQVQGALRKFLVKLR
Download sequence
Identical sequences adi_v1.15553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]