SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.16261 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.16261
Domain Number 1 Region: 55-214
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 5.19e-59
Family Tubulin, C-terminal domain 0.000000565
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 0.000000000000504
Family Tubulin, GTPase domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.16261
Sequence length 241
Sequence
MRDIVHIQVGQCGNQISSKFWEVISEEHGITPDGYCTGKDPIQVDRVNVYFDESSAHAPL
ISRGCQSYRSYGISELTSNMFGPQNMMVACDPRQGRYLTAAAMFRGQLAMREVEETISEM
QNAYSSAFVEWIPNNMKTAVCNVPPKGQKTAATFLYNSTAIQEAFKRFTDQFSAMFRRRA
FLHWYTTEGMDVMEFTEADSNMNDLIAEYQQYEETGLDEESYEEDDYEELVDFTGGASNS
I
Download sequence
Identical sequences adi_v1.16261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]