SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.17821 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.17821
Domain Number 1 Region: 98-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000602
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 2 Region: 19-57
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000011
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 3 Region: 61-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  adi_v1.17821
Domain Number - Region: 138-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00353
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.17821
Sequence length 160
Sequence
MLIWILLWVLPASVCSQNAVFTCSRDQFDCGDQRCIPNIWKCDGEVDCANHSDERGCSEA
FCNPDTKFQCKTTERCIPQRWLCDSDDDCGDNSDEPPDCTQRTCSDGEHACGNGHCIPFR
WVCDGDKDCSDNSDEQGCGNKTCKGSEFTCSNGKCISQAW
Download sequence
Identical sequences adi_v1.17821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]