SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.18861 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.18861
Domain Number 1 Region: 66-99
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 29-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.18861
Sequence length 128
Sequence
MDTEIHLPAVSKKISEIFISGQTCDVADVPNFICPSGKCLRTDLLCDSNKNCEDGTDEMR
CGLGMGCSKDEFSCADGGCVSWALTCNGENDCEDGTDEPFFCKKQGEPSIWENNNNSDKK
QTKHSSPK
Download sequence
Identical sequences adi_v1.18861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]