SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.19515 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.19515
Domain Number 1 Region: 27-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000641
Family LDL receptor-like module 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.19515
Sequence length 65
Sequence
MALGAALVSSAIAFFIFSPLQNTISATGFSCSSGQFECSNQRCIVSNWRCDNQDDCGDNS
DEVGC
Download sequence
Identical sequences adi_v1.19515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]