SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.20148 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.20148
Domain Number 1 Region: 453-621
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-20
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 2 Region: 221-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000301
Family LDL receptor-like module 0.00042
Further Details:      
 
Domain Number 3 Region: 183-223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000969
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 4 Region: 325-364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000105
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 5-115
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000432
Family YWTD domain 0.00086
Further Details:      
 
Domain Number 6 Region: 370-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 279-316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 411-444
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.20148
Sequence length 622
Sequence
IIETLHSGIQQVEGLALDWLGDNIYWVDAVGKKIEVSRADGRFRKSLISTNLDRPRAIVL
DPKRGTGLPHPYSISIYEESMYWDDWSTLSIQKANKRDGGSRQTIKSHIRGLMDVKIFHQ
DVQTGNNSCSRLKPCSHLCLAVGNGFSCSCPDNMVSVISAAGIVRCECSPGEHMDPVTKE
CKTTSGTCKTNEFKCTNGACVPSHWRCDHDNDCGDNSDEQNCPSRTCSSTQFTCSNGHCI
PASWRCDGDNDCGDYSDERGCSYTTRPTPSTAPWTRRTSCGSYEYTCNNGYCVYSWDVCD
GTDDCGDYSDELYCGTTAAPSMTPYTRRACHFWEFACSNGRCISWRLRCNGYDNCGDGSD
EVGCGTTSRPFCSSSEYQCAYGGCVPRYSVCDGISECYDGSDEVGCATPSPCTGFTCDRN
LCLSRSRICDGIRDCQDNADEKHCGDSLKVKIVSVTSINSTSVTVQWNPITVHPANVTFP
GYRVSHRSVSLHHVHDVGAWQSFHTGFVTSTIVSGLQPCSVYEFRVQVLLQGLPPGPYSD
VVPKGTPTSAVTASAPRNVQHVLKGRDSVLLTWEAPATYCSVITNYKVLYTRHGLGSFTS
VEVGNVLFYRLGLSGGHTYDIK
Download sequence
Identical sequences adi_v1.20148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]