SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.22040 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.22040
Domain Number 1 Region: 143-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 2 Region: 865-1148
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000101
Family Rhodopsin-like 0.024
Further Details:      
 
Weak hits

Sequence:  adi_v1.22040
Domain Number - Region: 502-537
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number - Region: 65-100
Classification Level Classification E-value
Superfamily FnI-like domain 0.00251
Family Fibronectin type I module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.22040
Sequence length 1190
Sequence
MLQQETFLFTLICIVVFVHDAKGFTCMDNQRNTRKPGDVWLEDPKKKCTCTSNNSVVCER
LFDPVCLDVNGKFRKNFETWLNGSCVECACVNGSVNCTVYDVIITPGLYKVDVSPTCQLC
EIRLQTALSSNACIAFRRQRAKLTECASGGFYIRDSHLCNGIEECPDGSDEKNCENVICK
DEEGKVLVVKSTMGWIVSKCLRCLCIEGLVTCNRTLTVFFPAFFGAFYKHEETCKQPSCK
ILDFVRNNKKWCEGAELIKDRGIIYEGQTWKANGCDFYFHGSLNDQEWPWMTRPVCYIFN
GFVCCASQCPALQQITGQMRGNLSFCANGRQVASKNSDCKDTRYCPQDINTQNCSSEVTC
QDEDGNHHCEGAEWFVGSCMWCKCKSGIMQCSRTVWLINYKFLELTQLEHQPIRAVAFTD
SCNQPECNVANYVEKNAGVCHACRWNDKLYYDGDHWKENGVDFFCIRSFYESHRVRPGCY
VESTRVKCTGAIAGIRQLSLISNHQLFLCDSGDEIRPISDRCDIRANCEDFSDERNCENY
YCSYETAHGFLWNRTQLGQQVQRQCSLVNPTWTGKFGSKCSQNVARTVWDHKNICNCENR
TLLEYFKKKNARANSTNFFDISEDLAISGKAKAFSNPRIFLNLNEELFLNITSRFLTPLT
LKNADIALQYCLSFINTTLSSPQYSVENKFCKAELVMERNSLIDKALRFLRQAPNQTEAH
RVGSGPNRWTVVDKEPHHTSGIKQRTYWPEFHQRVISSFRRQERQPLSLRLNTVPLVTPI
VEQTAIQGETAREKNVTSKNNTNQNTTRATHSNSTKDLTNKEGNGWLRANNCSEVTYEEE
KYVFIFKRDVSEEELKHEQRQSDMEIVLLCISIAAITLTLLLLTMLRLKNSERLFIHKSL
LFSLGIGNLVFVLDKTLFASREDHPALCSAVAVVQHYLHTAVFTWMLVEGINLYIKLVKV
FPVKKHYALYLGIGWGIPAVIMGLVASVRPSTFDMAESETTEITCGALNLTATKQRTRCW
MNGNLWIYKGPVLAILLVNFVLFAILLRVIFGKISSKYGNNHVMLARRGLRSIIALLPLL
GVTSLLGFFIEFHYILTYLFILLNCTQGVAFFIFHCILDDQVQGAMRKLLVNHGQTNKVK
QTCETPPSDHHSAERNFKIRTPQNSVDDSATNNGLTKNKREDGGENETHL
Download sequence
Identical sequences adi_v1.22040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]