SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.22205 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.22205
Domain Number 1 Region: 50-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 14-46
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.22205
Sequence length 90
Sequence
MSVLGQTSCDVADTPYFNCPSGKCVRTDLLCDSDKNCDDGTDEMRCGLGMRCSKDEFSCA
DGGCVSWALTCNGEKDCEDGTDEPLFCKKQ
Download sequence
Identical sequences adi_v1.22205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]