SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.23882 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.23882
Domain Number 1 Region: 2-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  adi_v1.23882
Domain Number - Region: 73-113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0155
Family MAM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.23882
Sequence length 202
Sequence
MSCSKDKFSCTDGGCVSWTLTCNGEKNCEDGTDEPSFCKIFLDSTNCSLLNVGCALSKNK
DIIARQVCAANQVKCDFEVGFCGMKHESKFHRWRIASSFTLTKSTGPPFDHTTFSTTVEG
ESQQGLKGRTKWSEAMKKDLLECKTKGLLLVNAEEPPRSSNGRKQGYMKIMKDLWEEKGY
ADLYEPAFTGSSSKVGEVRWAM
Download sequence
Identical sequences adi_v1.23882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]