SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.23984 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.23984
Domain Number 1 Region: 403-478
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000556
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 2 Region: 343-413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000103
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 3 Region: 463-521
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000473
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 60-131
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000945
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 5 Region: 125-198
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 6 Region: 526-585
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000133
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 7 Region: 189-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000306
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Weak hits

Sequence:  adi_v1.23984
Domain Number - Region: 262-312
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0288
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.23984
Sequence length 678
Sequence
MVSWEPVRATDNDRATVSASPAVTSPHEFTEGSHTVTFTAVDPSQNTKFCHFKVNVQVLR
CQGLLPPANGKLESGVCGNMFGRVCRLQCNKGYELKGSVVRTCDRISGTDQVHWTGNATY
CEAVECPSLNTTDHVEKIGYGCSGPTSTFGTVCFFSCILGFEVAGGSRHRTCQENREWSG
AQLQCRGVTCPAMNVKSEGLIVSPPACANSSVSLGYAAICRFTCKKGYQLVGPRLKTCAQ
NTRWFPLENPSCRDVSGPAFSNCPSNILKSADRGTTWATVTWTAPTATDNSEFIPNVTHS
GKSPGEKFAAGEHSIRYVGSDKTGNVGECKFKVFISVIRCVPRLHAPAGGTKFCTKDNIY
GSECSFSCHIGYTRVGSSKRVCEKNTTTSTGFWTGNETHCELVRCPRLHPPPNSIQSGCV
AGSDYNVFGGKCLFYCNMGYRKIKGSNERICREDGTWSGQALHCKVVRCQSLQAPDKGHV
SPSSCTVSPEYGTTCHFSCTKGYRLHGEPMASCLSDGQWSKDRNASCKVRRCSSLKAPQF
GFIYPYMCTSFPVSGTVCYLQCRNGFSGNGVSEMRCGKNGRWSSDESLILKCLDVVPPVF
LSCPSDIRANLGISSGVLVNWTIPVALDNSNMAPQISVSPPGVAPPYTFYNNTNIVYTAK
DPSGLERKCSFRVLLEGA
Download sequence
Identical sequences adi_v1.23984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]