SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.24648 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.24648
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000374
Family Ngr ectodomain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.24648
Sequence length 70
Sequence
HLANNKLTELPVFGPDAELTTLDIAYNPITRLDAATLEMYKSIESLYLGGTKITELRDSI
FSKNQELRTL
Download sequence
Identical sequences adi_v1.24648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]