SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.01794 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.01794
Domain Number 1 Region: 12-382
Classification Level Classification E-value
Superfamily Sema domain 1.96e-68
Family Sema domain 0.0000591
Further Details:      
 
Domain Number 2 Region: 378-419
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000575
Family Plexin repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.01794
Sequence length 456
Sequence
MKKFAKTFKPRGMNASTYYLLSIDERHNNLVAGARNNVFLVNLEDMESYKTTTLGEAPES
NQGYEFKAIETYNAPSSSPDQNDTAIITEDGTLFVDVDFVKSFEIGPYIYFFFRERSLEC
SSCGKVKTSRVARVCTGDRGGEYRLLDTFVTFQKAKLMCSDGKNYALNFNEIQDVWWDNR
TGRFYAAYSSQPNGPAISAICIYSLSSINRIFSESDFKSFTSETKVWTKKRNNIEEYFPG
CKVNPKYLKSSYSAVADGVMATKDMLPSAYGDLSHGPLMADGVEPVGSKAWFIRNGIRMT
GISVDVVGLNIVVYASTDRGSVVKISQPSGMSQPCLYSEMEVYPSNKKEVIKTMVIDQVR
HVLYLGTRYSLTQLSLDQCERYQHDKSACISGADPYCGWDNKAFRCSSVLSHGRRLQQNL
TICPNGRKEEPSRKSSDTYEETMGIMQGSSIDPRVF
Download sequence
Identical sequences adi_v1.01794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]