SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.02443 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.02443
Domain Number 1 Region: 36-175
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000282
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 164-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000944
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.02443
Sequence length 327
Sequence
MYNSITAWVEYVNTTRARVCVKELYAAKYDPLSVSYAVLSDLDECTSGSHSCDVNSVCQN
AVGSYTCSCNAGYTGDGKPCNDIDECSTSSHSCDVNALCSNIVGTYACACKAGYSGDGRT
CADADECSNNDHSCDVNAVCSNTVGSYACACKAGYTGDGRTCNDVDECTSGLHSCHRFAS
CTNTIGSYSCSCQQYFNGNGTNCQHPVSECQNYASLNSGDRKITYTSAQVYCDNGIGPGW
FRFEGSAGTRMPTSCPPQSRCATHATGWLNGGHPTVADGQVSRLVCFHWSSRCCYGSTYI
NVRNCGSYYVYFLSGTPGCYYRYCGTN
Download sequence
Identical sequences adi_v1.02443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]