SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.04488 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.04488
Domain Number 1 Region: 1-225,261-287
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.09e-66
Family Tubulin, GTPase domain 0.00000839
Further Details:      
 
Domain Number 2 Region: 292-470
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.78e-57
Family Tubulin, C-terminal domain 0.0000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.04488
Sequence length 486
Sequence
MTQSIVVQVGQCGNQIGCRFWDLALREHASTNKNGIFDESLSSFFRNVDTRYKNPIDIPL
GNSKQKIKSLKARAVMIDMEEGVVNEILKGPLRDVFDCQQLITDVSGSGNNWATGFMMYG
QRYREQISEVIRHAAELCDCLQCFFLIHSMGGGTGSGLGTSVLNLLADEYTDVYRFTSAV
YPSADDDVITSPYNSVLAMHQLTEYADCVLPIENQALVDICNKVSSALPPTKTGKKVYHQ
SSQCHIKASSAITSSDGGVKKGPEKPFDNMNNIAANLILNMTSSSRFEGSLNVDLNEITM
NLVPFPKLHYLVSSQTPLYSLTDVKLPPRRLDQMFSDAFSKDHQLIKADPKHSLYLACAL
MLRGNVEISDIRRNIERLKPSLQFIHWNQEGWKTGLCSVPPVGNPYSLLALSNNTCIRHT
FGELKDRFMKLYKRKAHVHHYTHVDGMEASQFDSSIESLNGLIQEYETLEAQMGRTVEDI
PRLKIA
Download sequence
Identical sequences XP_015757384.1.88439 XP_015757385.1.88439 adi_v1.04488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]