SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.05559 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.05559
Domain Number 1 Region: 252-351
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000148
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000135
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.05559
Sequence length 354
Sequence
MILRTGCLYVFKKPESSNFHEAIPLSSYRVCDALEVSKYQWVFKLVHLTEIKTIFFAVDT
EFDLKKWKDAIIKDKDSFCGSHYTEIEEGNQTPQKPLPPLPPAAEKARPRPPAPPPSRYG
STPRPLPHPAPQPLPQREGQRESSPHTFPKPKPPASLPRPVPVLPETASLGGIPARREMR
RSISEKNLVGKPGYDNVVQQFKGSALSFIHEGSAHPGKSARHPPDGCELQGELQNEERQV
SRGAGTSFIPNVYSSDMTKEAATRVLKSEQPGTYLTRPSAESESGRSLSVRDKNADSAAP
LVRHYRIFYKESLGYAINTKGPRFPSIPKTLEHYHQNELPNTKQKLRKPYIPRL
Download sequence
Identical sequences adi_v1.05559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]