SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.09047 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.09047
Domain Number 1 Region: 235-489
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-46
Family YWTD domain 0.00000534
Further Details:      
 
Domain Number 2 Region: 56-94
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 10-45
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 121-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 163-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.09047
Sequence length 548
Sequence
MSQYLILAPRPCNGTDEFKCSNNECVLQSDVCDGINDCTDGSDEATDSGPRCGTVGCASD
EFTCDNERCIPSSQRCNGVDNCNDGSDERSCPSPTPTVSATSTQPSRSAAPTLRPTNATQ
TPSSCEAGYFFCSSSATCVTKNKVCDGNADCSNGEDEENCGGCKSYNGHCLQQCHETMSG
HYCSCNVGYKLMDDKKSCEDIKRVMRPKSFWTFESDASLLANELLFLPSEPRASLIFSNG
RDIRQISTDGSEYKKTVPDLKNAGSLDFDFKTSTIYWLETREKKVQRARIGQNIAPKVDN
VLENGMPCATKIAVDWVGRKMYWACRGAIEVSQMDGSLRRTLLKGDILKPSAIALDPSER
RLYWTDWSDPAKIERASMDGSEREVLISGLHLEMPVDLTIDYTNKKLYWVDFKLRVIKQC
DLDGKNVREIVTRGIKKPSALTLFEDHVYWIDDKKIYKANKFTGKNVSVMVNEAFAPTDL
RIYHPQRQPMVEDKVFLVGDAQGKKVRSFKADMKTNFENVNFKDENNVEEYGDDDCRRKI
IPLEEDIV
Download sequence
Identical sequences adi_v1.09047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]