SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.13275 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.13275
Domain Number 1 Region: 437-539
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-22
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 62-192
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-21
Family Phosphotyrosine-binding domain (PTB) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.13275
Sequence length 573
Sequence
MFKRKNKTKQDILRIKGEQQENQPPDAVSSNGDVVDGFDTQGFVDLTSEEHQPKLLGPQQ
NCKYVGTFPVSLGSSSDGETTLTTHKERTKFVKKKLREYRYAEKGVKVSLLISKDGIKVI
TPDAQRVRMAHALQRISFATCDPEFRLFAYMSHNPSPLGTAIHCHVFMTRDTRQVQSLTA
LVGKAFQVAFAESKFPRGAELKMNPIQRTSPEDRVVQGRRWARLEAEQGHEHSQHAIIAR
IKKEQEKEKNKSPNKSREEVIPKESSVITSSKTQEAPLGRQRSFGKARTPPHARRPDVLQ
QKNNVSAEATRQKTKLSDNVVADGAFDGSTVADVHGKTIENVTEGQAVAEKKLNHGTNEL
HAQRDDPRPFSSVSSHEQDSPQTEPLPPLPPPKMNIPSEAASLPENLMMSPLAKSASDPN
LLNSHSDRKHVRVSRHNSHEDENWYLPGIPREFVTEMLQQAEEGSFFVRDSHSRPGCFAL
TMRVPREANPSGFANFLIVKVKDGVMIQGFDKVLKDVTSLVEHYSQHAGELPCKLMIGRS
NVLCENDDYVNMVPDDPDYQMLSDFTSMMEELN
Download sequence
Identical sequences adi_v1.13275 XP_015754207.1.88439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]