SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for adi_v1.15030 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.15030
Domain Number 1 Region: 184-246
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000148
Family Canonical RBD 0.017
Further Details:      
 
Domain Number 2 Region: 803-842
Classification Level Classification E-value
Superfamily SPOC domain-like 0.00000114
Family SPOC domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.15030
Sequence length 859
Sequence
MQSGPGVASGGGGSTSSRSRAVSSNSRSHQRQQTFNQEPRRSSRKPKAYRDQEPSPDHSS
GSESGSESSGSQSASSSGSSSSSEEASREGSVHGALPPPEPPQGLIRSSSLCLRNILARS
GGRVDFFFQPEDAERGYEACRGKMFLGAEMDLQYHTQDDRFESNDHPPHHRSYAGVMMDN
DFDPGCTRTLFVGNIEKATSISDLKEAFERYGEIVVEFVSRDSRQLFYDALQRSGPSDSN
IRRYEPSPPRSRGRGGTAGYYENRWERSRGGRGHMRRDMPNHRPWHRGEYDYPEGSGYHQ
RVHTRYRGPYEGGGYDSDDYDQELRDYNYSRQREREKEQGRQRHERGGRDRDREDGNFSG
NERYYPENQDRWRDDRSSSGSYEDQLDRKDIRPREFPDGHERERGGYSEDDERASGHSKP
PGHDFEPDEKRKKEALRAVEAPTEEKLVGVDKKKKIKIEDGEIIGKSKGGGDRDWHEPHI
QGSGSKSEKELPSRESKDNLSAPTSPPPLVEKSTKRKERKDKRRKHRRSQASLGEEEEER
EQEQETTGLEDAHPSQVVAETAKVPATKQRPSIDESDPQKFDNRDSHSAPENDIYERVES
EEKPPRRHSADEWLPKEERELSRNTASHSPRNKLHRDDRRRDVEKHEGTRPKRRRLSNGE
SPPPPPPPPPPPREAGEAVPSHLDVVQRGAQIAVDGTSAQIPRTSYEVAQAATHFEPQVY
DANHVVPVGVSPASIPLNPASAAAPIIGTPPLTVHSPGVTIGVTSAAALASPPVMVPPPP
PPHPDYNTPPSVPQQANPDTLLDLLRRYPVVWQGLLALKNDSAAVQMHYLAGNGRLAENS
TADEAGAFTTGGSHTENAV
Download sequence
Identical sequences adi_v1.15030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]