SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for adi_v1.16329 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.16329
Domain Number 1 Region: 39-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000877
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 113-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.16329
Sequence length 212
Sequence
MAKPDHTYEEFYGKGKKNKIIHIPKNSFWSPGMKLTREASCANNRYRCEGGKKCIPLKWI
CDGVNDCEDRLDERNCFFANETNISSDANPKQGGFSQESSEGCPRNTYSCDEVCESNKFS
CDENAKCLPLGWVCDRINDCNDQTDEHNCPNKRTGKSLARAAEEAALTAAQEAKHAAAAA
QDFMLKAKVAAEKARRALLIAETNRQKYTNKP
Download sequence
Identical sequences adi_v1.16329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]