SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.17937 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.17937
Domain Number 1 Region: 355-488,825-1004
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.32e-49
Family Diacylglycerol kinase-like 0.0074
Further Details:      
 
Domain Number 2 Region: 87-207
Classification Level Classification E-value
Superfamily PH domain-like 2.04e-21
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 3 Region: 1196-1260
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-19
Family SAM (sterile alpha motif) domain 0.0028
Further Details:      
 
Domain Number 4 Region: 265-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00043
Further Details:      
 
Domain Number 5 Region: 195-252
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000924
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.17937
Sequence length 1293
Sequence
MGLQIDGSEVTQLPTLAVVSRGLEKNGGHHIADKKIEKMAWRRSYDFTLRMEESEFDSSD
ESDSEGGAETINTYHRRKSTVTAVKSKSCIKEGFLLKQTGSFQRWKRRYFKLIEGNKLFY
AKSSEETVFSEIDLQDFSVAASGIKNDNNSFSVITAFQNVELSADSRKEMDEWICALKSV
SSRTSSRSDLLDILSGGHNWYSCSHSKPTFCNVCRDLLSGVTSKGLSCEVCRFKVHRRCA
VRAKNNCKWTTVQSVRKDHCNFDESDPLSIPHQWLEGNLPPSAKCSVCDQICGSKRRLQG
FRCLWCNVMVHQSCQSQIPRCSYGDNALFTLPPVSVLSSCGSLVWNAGKPSGCLPMLVFV
NSKSGDNQGVKFIRKFKQLLNPIQVFDLALGGPSKGLKLFKEFEHFRILVCGGDGSVGWV
MNEVDQQNLSNQCQLGVLPLGTGNDLSRVLGWGTSFVDDNAVTQFLQHLERAKAAVLDRW
SIMIEERPLSASRSSSIETLDTPYRQEFGTIDMFENNVATHLTRILHSSKHSEVISSARV
LCETVKDFVSKVGTASANSEPWQAEEPDSLTQKCTVLNEKLNLLLNTLSIESEALSTPSR
ESLDTSGNSGIGSGKPRVFVSKEALMSRANSLKKALKHIIEHAEKAVDEQNAQTSASTSS
LAEAFVTVAVTAAGQVVTTSTARTERGLEPIQDNEGNILNSEEDSCAGESDPSTSDNRLR
DTEPTSGSWTAPESRRLSQSRCISKGSSHPFSSDPMLEEKLLGNAGKPTVQFSGCIISRA
FLKERPSEGLVGSWIGRALLANADALCAAASPMMNNAFDVEGYTEKCVMNNYFGIGLDAK
IALDFHLRREEHPEKFRHRALNLLYYGLLGGRELLHRTYKNLDQRVRLECDGHKINLPSL
QGIVVLNITSYMGGANFWGTGRDDGFMEPSNDDNILEVVAVLGASQMGMSKVFGGMQHHR
IAQCRVVKISIFGESVPVQVDGEAWMQSPGYIKIVHKNRTQMLVRDREFETTLKEWTEIQ
QEKVTSCVTNVQAEVLTSLVHSLSILVNSVKTVCESRGTELQDLSSLADTAATSIERLVL
EGKIPEAPSKGKITDLVTNGRTLLQGVSDFLHSLSELEPPVQIFETERNLWSAISTVKSL
INKTIEAYALTNLSEEEVERQGSNKGKGKFKLGFLRSSKKPEMTKVGSAPSGRMIQFWGV
EEVGNWLESLGLSEYKELFAKHDIRGPELLALDRPDLKDLGVTKVGHIKRILHGIKALCG
GVSPKSAARIERTPKAEEKAGRNKRVIDKEDSH
Download sequence
Identical sequences adi_v1.17937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]