SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.19410 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.19410
Domain Number 1 Region: 225-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 192-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.19410
Sequence length 382
Sequence
MVTSAESSPIKETGKRKKVESSASRKLFEEDSTDRECHGTSLKLTPEVWAGIPVQEVKIL
PYDIDGVQIFRLNYDRPDKMATTLDWRQWSGYITSRRSGFVGKRFIKSCKGSHRCGNELC
GYFRQFKKMNRGHFEKKGSVVKCSTCEATAEFVPCSVSYKHVDTEIPLPPISREVSEVFL
SIPTGQSCLVQDASHFSCPSGECLRADFLCDTNENCKDGTDEIRCAGTSCSKDKFSCADG
GCVSWTLTCNGEKNCEDGTDEPLFCRIFLDSTNCPLLNVGFAFISVNKDIITRQICAANK
VKCDFEVGFCGMKHASKFHQWQIASGFTLTKSTAPPFDHTTFSFTGRLSLMRATVASPAC
PLPRAPVHFFTSQDNQKKIFAF
Download sequence
Identical sequences adi_v1.19410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]