SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.20911 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.20911
Domain Number 1 Region: 136-191
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000148
Family SH2 domain 0.0017
Further Details:      
 
Domain Number 2 Region: 9-58
Classification Level Classification E-value
Superfamily PH domain-like 0.000025
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.20911
Sequence length 191
Sequence
SSSFSSGKKSKDKFEFAIKAEKGKKYLLRVGTESLRLQWINSLELAAQGKPSPERFAPLQ
ETVEEEKTSNQYTEVPNPTCSTSSDICEVIQEDMNKMFSRKHNSFGDHCKRLLRTKSKSF
CQEESREPVSEGTDAKSEPFYDIVPHQNPPWYFGKLSREQSEEILQNYEPGRYLVRNSES
VHKPGAYTLSL
Download sequence
Identical sequences adi_v1.20911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]