SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.23417 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.23417
Domain Number 1 Region: 83-122
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000079
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 2 Region: 48-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000402
Family Ovomucoid domain III-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.23417
Sequence length 219
Sequence
MGLSISQLREGNCASINPCKPNPCQADENDIWCPMIQFVLPVSEGKYCSDRQLDPVCDTA
NQQHPNLCSLQFNSKSLAYRGFCKDECKPPLPSVCGVNGETYSSTCAANSARVIVDYQGR
CKAVGVGEGNEPRCKNVTCPAIKPTHCKGIIPPGACCPHCDIVLSGLKGARSDLPTLSAK
PPKRVYDSHSSKANQVNNSLIVLLLPIVILPVMLRTGRS
Download sequence
Identical sequences adi_v1.23417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]