SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.24462 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.24462
Domain Number 1 Region: 308-546
Classification Level Classification E-value
Superfamily SIS domain 1.42e-17
Family mono-SIS domain 0.00072
Further Details:      
 
Domain Number 2 Region: 98-214
Classification Level Classification E-value
Superfamily SIS domain 0.00000000512
Family mono-SIS domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.24462
Sequence length 625
Sequence
MTSRRFGRWKKVTTGVLTHGLNSSKLLCFLTIDGIIMAADVGDCLYQESRTAPITEQPNE
FARDIDCGCASDIVRTLCQCDSQIFSGWENYPTLYDAKTISSMVKISEWAVEVLENSNDT
AIVLSGCGTSGRMAFFLARKFSQLAEAQQMSANYDYLIAGGDVALLTALEATEDDWRQGR
EDLEKVSGNKSRVLFIGITCGLSAPYVAAQLDYCMCRPDVFIPVLIGFNPLKQAKQNVIE
GWNKSFFQVARSLQDYNKGVILNPVIGPEAITGSTRLKGGSATKIILESILLHAHITLKN
SKSTPINILLKLLAIFNETCSSTYHESTNISRAVELGAQSLQSNGHVYYLGWGFPGLMGL
LDASECVPTFSANYDDFRGFLQGGYRFLKNSHGEMVMADSMKLPISLEDFRCMFLTKLTS
HDTIIFLCPGVKDTEEVVRLFQLVDERQAHIVGIFCEGQKSLSNLFLKYSVSFNQPSKVE
QFLEPELANFVQECQTELFTKLVLNAVSTGAHVLKGKVVGNAMIDLKVSNSKLFHRAVAI
VSKFARVSQQKSLHCVLQSIYRTDEVDNVLTRPISEHVAKSSLVKKVVPVALLLATGKFR
IESALTVLKTNTVSSVLRDLNYFPC
Download sequence
Identical sequences XP_015757026.1.88439 adi_v1.24462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]