SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ARB_00915 from Arthroderma benhamiae CBS 112371

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ARB_00915
Domain Number 1 Region: 207-662
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.57e-130
Family Trehalose-6-phosphate synthase, OtsA 0.00000467
Further Details:      
 
Domain Number 2 Region: 691-889,928-948
Classification Level Classification E-value
Superfamily HAD-like 2.36e-20
Family Trehalose-phosphatase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ARB_00915
Sequence length 1005
Comment | Arthroderma benhamiae CBS 112371 alpha,alpha-trehalose phosphate synthasesubunit, putative (1006 aa)
Sequence
MTIFIVSLALFADRASFLPHTIDFALPEGYQRKASHHHRRKSSGQRATLFGRLPGSQTAT
PTSASASTSASTSTATTATTSAAASNHASGSTVAGRRPSSLRDQGRIFSCPDYSSSGIEV
TSQQPRLLAPSDPHSPRWGSPGAFNQPKAQALAPPSSSILNHALGQESASELSRTEPTVL
PPSPVRPSIEPGSQPNQESVFESAEWTVQPSEQGNGGLLNAIRSAVDWPYMKDKLWVGTL
GMPTDALHEKQKEAIAEKLAADYEALTIFVSDNDFDSHYLHFCKMILWPVFHYQIPDNPK
SKAYEDHSWIFYRRVNYNFAKELIKNWKRGDVIWVHDYHLLLVPAMVRKEIPDAQIGIFL
HVAFPSSEVFRCLSVRVELLKGMLGANLIGFQTQEYCHHFLQTCSRLLNVEATKDGVQLE
DRFVNVGTFPIGIDPVSLDIRRQCGEVKSWINILQEKFKGKRLIVARDKLDNVRGVRQKL
LAYELFLNKYPHWRDSVVLIQVASTTTEQPELEASVSDIATRINSVHSNLAHQPLIFHKQ
DLLFDQYLALISVADVFMVTSLREGMNLTSHEFIHCQDGLLSSSKHGPLILSEFTGSASI
FNYHPLLVNPWNYQECADAINTALEMSPETRLAQWTRLNTTAKDHVTTRWVNNFTEALDR
AYRQHSTRETVAVPRLSIPNLCNAYRTSSRRLLILDYEGTLVSWGQPTSTVLTTPQRAID
TLTDLLEDPLNTVYVMSSRMPEDMERLFSRVPGLGLIAENGCFVRPPPMLSPTPSPPTTG
TFVTSNWIRLIDMTKMNDWKLSLSPMLRYFQERTEGSWIEETHASLIFHYERAEDSQSAE
RHASECANNVNDSCGNHSLRAIQMDGCVVAGPVEPNKGTAANVVFSTYTRRESRRSSSAG
SASSAKQGMAIEWKSETEDNDEDVPDFILVIGDGRDDEPAFRWANELGEEKKVKNVMTVT
LGFKNTEAMATLNQGVTGKLVDISQRRDSASLAQKLSYIPASNGE
Download sequence
Identical sequences D4AXJ6
XP_003012664.1.35196 ARB_00915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]