SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G26760.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G26760.1
Domain Number 1 Region: 189-252,320-402
Classification Level Classification E-value
Superfamily SET domain 1.57e-26
Family Viral histone H3 Lysine 27 Methyltransferase 0.06
Further Details:      
 
Domain Number 2 Region: 21-136
Classification Level Classification E-value
Superfamily TPR-like 4.43e-17
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G26760.1
Sequence length 545
Sequence
MRGEQFELEEDRDGPLELLQSLRSKATELLLREEWEESIKVYTEFIDLSRRQVSSTGGSD
PDPDSIAKLRKSLCLALCNRAEARARLRDFLEAMRDCDQALEIEKTHFKTLLCKGKVLLG
LSKYSLALECFKTALLDPQASDNLETVTVYIEKCKKLEFQAKTGAFDLSDWILSEFRGKC
PELAEFIGSIEIKKSELSGRGLFATKNIVAGTLVLVTKAVAIERGILGNGECGEKAQLIM
WKNFVEEVTESVRKCGRTRRVVSALSTGQGEDSLEIPEIALFRPDEAFETCGDWKQSLDT
EKLLSILDVNSLVEDAVSGKVMGKNKEYYGVGLWTLASFINHSCIPNARRLHVGDYVIVH
ASRDIKTGEEISFAYFDVLSPLEKRKEMAESWGFCCGCSRCKFESVLYATNQEVREFEMG
LERGVDAGNAVYMVEEGMKRWKVKGKDKGLLRASYWGVYDEIYNSERLMKRWGRKIPTME
VVVDSVSDVVGSDERLMKMAVEGMMKKHGGFSNIVEMEKIMKLGKGVYGKVVSKKKAMKT
LLGIE
Download sequence
Identical sequences A0A178WP70 F4HPB8
3702.AT1G26760.1-P AT1G26760.1 AT1G26760.1 NP_173998.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]