SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G75510.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G75510.1
Domain Number 1 Region: 186-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.33e-20
Family DNA-binding domain from rap30 0.003
Further Details:      
 
Domain Number 2 Region: 5-120
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.00000000199
Family Rap30/74 interaction domains 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G75510.1
Sequence length 261
Sequence
MEDIHNLDIEKSDRSIWLMKCPVVVDKAWHKIAASSSSSFASSDSPPDMAKIVREVDPLR
DDSPPEFKMYMVGAEYGNMPKCYALNMFTDFVPMGGFSDVNQGCAAAEGKVDHKFDMKPY
GETIEEYARLCRERTSKAMVKNRQIQVIDNDRGVHMRPMPGMLGLVSSNSKEKRKPPPVK
QTEVKRTRRDRGELEAIMFKLFEGQPNWTLKQLVQETDQPAQFLKEILNELCVYNKRGSN
QGTYELKPEYKKSAEDDTGGQ
Download sequence
Identical sequences A0A178W1N6 Q9LQZ4
NP_177683.1.80155 3702.AT1G75510.1-P AT1G75510.1 AT1G75510.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]