SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT3G52270.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G52270.1
Domain Number 1 Region: 199-265
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.93e-18
Family DNA-binding domain from rap30 0.0035
Further Details:      
 
Domain Number 2 Region: 19-136
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.00000366
Family Rap30/74 interaction domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G52270.1
Sequence length 269
Sequence
MSLREMEDVKVEMKVRKNENEALETGLAERSMLLMKAPSLVASSLQSHSFPDDPYRPDDP
YRPDAKVILGVDPLAHEDEGTQFVMELARADSGNMPRRYTLDMSKDFIPMNVFCESSDGK
MSVEGKIKNKFDMRPHNENIESYGRLCRERTNKYMGKNRQIQVIDNARGMHMRPMPGMII
PTAAPEKKKLTNRTSEMKRTRRDRREMEEVMFNLFERQSNWTLRLLIQETDQPEQFLKDL
LKDLCIYNNKGSNQGTYELKPEYKKATQE
Download sequence
Identical sequences F4J6V5
AT3G52270.1 AT3G52270.1 NP_190795.3.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]