SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT4G16310.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT4G16310.1
Domain Number 1 Region: 617-958,1061-1105
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-70
Family FAD-linked reductases, N-terminal domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 940-1051
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.42e-30
Family L-aminoacid/polyamine oxidase 0.00033
Further Details:      
 
Domain Number 3 Region: 376-474
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000412
Family SWIRM domain 0.035
Further Details:      
 
Domain Number 4 Region: 1188-1273
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000000536
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT4G16310.1
Sequence length 1628
Sequence
MDGKEKKSGSKRGSKVFQFDDDADDDEPIGSLLEIMKHKSSKKDKVETESTGKQRQKQVV
EKKLSALGKDSEDMDDTLASFRKRLKGNKKGVESGTSRVRNHEGVDTVTNSNLKPIEEAN
KNEVQSVLLRENGASNSIQKCASETGTLLHKFSGKDKAASPSHEKVETVSSEKEADVFHQ
ITKEESEIPMSEKAVELSRVSVPMPDVHGEVNCTIAPDKHIHLGEPTSESGYYREKNLVM
CDCGTQFNFEDRSFESNTQVTLCQKCKYSSHHNASNGGGIQVNTLEDGTAQASPVSIIPC
EDENFRGDAISLPNSGKPSTLQRPERIAKKRKLGNMVYEGDVKWENEQGFLDCQSDKSFK
GSDKCGFVPSISKEIEIGRAAAVTAGLKAQSVSPIEKIILKEVLKRKGSNQEYLVCRNSI
LGLWSKNVSRILPVTECGVTGGPSESELPSASLIREVYKFLDQRGYINAGISSVNGKAAS
STNQDYDLLQGRQLEESSMASVADSEEGVAFILGQVKAVESTSEGKKCALQNDERDLVGC
ATSEMLESISKKCEASIIDDNKRSVSMNALQDSTASNVEKHPETFSVAKPALSSTLSSAH
SNQMRGRDCVPCEVIDEKKVIVIGAGPAGLTAARHLQRQGFSVTVLEARSRVGGRVFTDR
SSLSVPVDLGASIITGIEADVPSERMPDPSVLVCNQLGLELSVLHGFCPLYDTVTGKKVP
AELDDALQAEFNSLIDDVDLLVEEIGKERANKMSLEDGLEYGLQRLRMPHDKVNIDKFGL
LNSSSKTGIRGPFMQDESWKDDFLNPLERRVMNWHFAHTEYGCAAVLKEVSLPHWNQDEF
YGGFGGPHAMIKGGYSRVVESLAEGLDIHLNKIVSDVSYVSDVSAMDNSKHKVRVSTSNG
CEYLGDAVLVTVPLGCLKAETIKFSPPLPDWKYASIKQLGFGVLNKVVLEFPTVFWDDSV
DYFGATAEETDLRGECFMFWNVKKTVGAPVLIALVVGKAAFEYTNKSKSEHVNHAMMVLR
KLFGGDLVPDPVASVVTDWGTDPYSYGAYSYVAIGASGEDYDVLGRPVQNCLFFAGEATC
KEHPDTVGGAMMTGVREAVRIIDILRSGNDYTAEIETLEKAQRKSVPVRDEVRDLIKRLE
VVELSNVLARQSLLRNMFFSAKTTVGRLHLAKELLNLPGETLKSFAGTKEGLAVLNSWIL
DSMGKNGTQLLRHCVHILVRVTSDLFALRLSGIGKTVKEKVCAHTSRDIRAIASQLVNVW
LDLYRKEKANSGKKSLRQANTTNTSRIRRKLNSPDTDSKGKLSNGNDVKTDEEFEDNQLP
MSEEEKAVFAEAEAARAAAEAAAKAFSEAYHNTSLQLPKIPSFHKFARREQYAKMDESDF
RKKFPGNVLGRQDCMSEIDSRNCKVRDWYDFPASCLDLDSARIPVDNYSQPSHSNELVSH
SKFRECSGESVAADTSFLTGAWVDTGGSSDGFKDSQAIDRWQSQAAAADPEFFNRTLHIK
DEEDSIACSTGPPSWKHDQRANECSVSQVTVNKEPHKNHIRSADRLKQGVVDFVASLLMA
PYRAKKIDRDVYKSIMKKTATKVMQHTTDVEKAMAVTQFLDSKRKNKIRDFVDKQVDKYM
VIPQVPKP
Download sequence
Identical sequences F4JLS1
NP_001319957.1.80155 NP_001328664.1.80155 NP_001328665.1.80155 NP_001328666.1.80155 NP_193364.5.80155 3702.AT4G16310.1-P AT4G16310.1 AT4G16310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]