SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G13825.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT5G13825.1
Domain Number - Region: 65-108
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0118
Family Methyl-CpG-binding domain, MBD 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G13825.1
Sequence length 124
Sequence
MEAESSSSGHRRQKRPRQKRSSDVISYESSVANLSREGKETLMIVSRRRQLNKIPNTSST
VFDNTCPRYNWLRSGWIAEERLKVYDRLYRYFYDPLGQMYHTRGEVDQIYADIEKSRAIV
VFRK
Download sequence
Identical sequences A0A178UKC3 Q5XV41
NP_680167.1.80155 AT5G13825.1 AT5G13825.1 3702.AT5G13825.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]