SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT5G51050.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G51050.1
Domain Number 1 Region: 205-479
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.27e-75
Family Mitochondrial carrier 0.0000636
Further Details:      
 
Domain Number 2 Region: 26-206
Classification Level Classification E-value
Superfamily EF-hand 6.16e-34
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G51050.1
Sequence length 487
Sequence
MEATKSSKQNCCNPVKKPGPVSIDHVLLALRETREERDLRIRSLFSFFDSENVGYLDCAQ
IEKGLCALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRIFQAIDVEHN
GCISPEGLWDSLVKAGIEIKDEELARFVEHVDKDNDGIIMFEEWRDFLLLYPHEATIENI
YHHWERVCLVDIGEQAVIPEGISKHIKRSNYFIAGGIAGAASRTATAPLDRLKVLLQIQK
TDARIREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENMGEDKAD
IGTTVRLFAGGMAGAVAQASIYPLDLVKTRLQTYTSQAGVAVPRLGTLTKDILVHEGPRA
FYKGLFPSLLGIIPYAGIDLAAYETLKDLSRTYILQDAEPGPLVQLGCGTISGALGATCV
YPLQVVRTRMQAERARTSMSGVFRRTISEEGYRALYKGLLPNLLKVVPAASITYMVYEAM
KKSLELD
Download sequence
Identical sequences Q9FI43
GO.20941 3702.AT5G51050.1-P AT5G51050.1 AT5G51050.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]